SitesBLAST
Comparing 8500403 FitnessBrowser__Miya:8500403 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
4r1mA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution
59% identity, 97% coverage: 8:430/434 of query aligns to 12:434/435 of 4r1mA
- binding adenosine monophosphate: A215 (= A210), E216 (= E211), P217 (= P212), N236 (= N231), S237 (= S232), F238 (≠ Y233), G239 (= G234), M240 (≠ L235), T241 (≠ S236), D305 (= D300), R329 (= R324), I335 (= I330), N340 (= N335)
- binding zinc ion: C252 (= C247), H259 (= H254), C314 (= C309), C316 (= C311)
4r1lA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution
59% identity, 97% coverage: 8:430/434 of query aligns to 12:432/433 of 4r1lA
- binding adenosine-5'-diphosphate: A215 (= A210), E216 (= E211), P217 (= P212), S237 (= S232), F238 (≠ Y233), G239 (= G234), M240 (≠ L235), T241 (≠ S236), D305 (= D300), R329 (= R324), N340 (= N335)
- binding adenosine monophosphate: A215 (= A210), E216 (= E211), P217 (= P212), S237 (= S232), F238 (≠ Y233), G239 (= G234), M240 (≠ L235), T241 (≠ S236), D305 (= D300), R329 (= R324), N340 (= N335)
- binding coenzyme a: S136 (≠ M131), A164 (= A159), G165 (= G160), N166 (= N161), S167 (≠ T162), I185 (= I180), Y188 (= Y183), K337 (= K332), T408 (= T404)
- binding zinc ion: C252 (= C247), H259 (= H254), C314 (= C309), C316 (= C311)
2y4oA Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
46% identity, 97% coverage: 8:430/434 of query aligns to 10:433/433 of 2y4oA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ A132), F140 (= F137), A213 (= A210), E214 (= E211), P215 (= P212), I235 (≠ S232), G237 (= G234), L238 (= L235), S239 (= S236), P244 (= P241), D304 (= D300), R325 (= R324), I331 (= I330), N336 (= N335)
2y27B Crystal structure of paak1 in complex with atp from burkholderia cenocepacia (see paper)
46% identity, 97% coverage: 8:429/434 of query aligns to 8:427/427 of 2y27B
- binding adenosine-5'-triphosphate: K65 (= K64), S90 (= S89), S91 (= S90), G92 (= G91), T93 (= T92), T94 (= T93), F138 (= F137), A211 (= A210), E212 (= E211), P213 (= P212), D232 (≠ N231), I233 (≠ S232), Y234 (= Y233), G235 (= G234), L236 (= L235), S237 (= S236), D302 (= D300), I320 (= I321), R323 (= R324), K419 (= K421)
- binding magnesium ion: V200 (≠ A199), S202 (≠ L201), L204 (= L203), M226 (≠ L225), G227 (= G226), Q347 (≠ F348), L350 (≠ V351)
2y4oB Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
46% identity, 97% coverage: 8:429/434 of query aligns to 10:432/432 of 2y4oB
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ A132), F140 (= F137), G212 (= G209), A213 (= A210), E214 (= E211), P215 (= P212), I235 (≠ S232), G237 (= G234), L238 (= L235), S239 (= S236), P244 (= P241), D304 (= D300), R325 (= R324), I331 (= I330), N336 (= N335)
- binding magnesium ion: S204 (≠ L201), V228 (≠ L225)
2y4nA Paak1 in complex with phenylacetyl adenylate (see paper)
45% identity, 97% coverage: 8:430/434 of query aligns to 8:426/426 of 2y4nA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: Y131 (≠ A132), F136 (= F137), G138 (= G139), G208 (= G209), A209 (= A210), E210 (= E211), P211 (= P212), I231 (≠ S232), Y232 (= Y233), G233 (= G234), L234 (= L235), S235 (= S236), P240 (= P241), D300 (= D300), R321 (= R324), K417 (= K421)
- binding magnesium ion: V198 (≠ A199), S200 (≠ L201), Q345 (≠ F348), L348 (≠ V351)
6he0A Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state (see paper)
34% identity, 97% coverage: 12:430/434 of query aligns to 29:465/477 of 6he0A
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] 2-methyl-2-oxidanyl-propanoate: S241 (≠ G209), G242 (≠ A210), E243 (= E211), P244 (= P212), G267 (≠ Y233), S268 (≠ G234), M269 (≠ L235), A270 (≠ S236), D335 (= D300), I357 (= I321), N371 (= N335)
- binding adenosine monophosphate: G242 (≠ A210), E243 (= E211), P244 (= P212), C266 (≠ S232), G267 (≠ Y233), S268 (≠ G234), A270 (≠ S236), E271 (= E237), D335 (= D300), N371 (= N335)
- binding coenzyme a: Y166 (≠ F137), A188 (= A159), G189 (= G160), P191 (vs. gap), S194 (≠ T162), Y210 (≠ H178), G211 (≠ I179), T212 (≠ I180), Y215 (= Y183), H218 (≠ Y186), R368 (≠ K332), G369 (= G333), M401 (≠ R365), V439 (= V403), R440 (≠ T404)
6hdyA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with s3-hb-amp (see paper)
33% identity, 97% coverage: 12:430/434 of query aligns to 29:462/474 of 6hdyA
- binding (3s)-3-hydroxybutanoic acid: Y162 (≠ F137), S237 (≠ G209), G263 (≠ Y233), S264 (≠ G234), M265 (≠ L235), A266 (≠ S236), F271 (vs. gap)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (3~{S})-3-oxidanylbutanoate: Y162 (≠ F137), G164 (= G139), S237 (≠ G209), G238 (≠ A210), E239 (= E211), P240 (= P212), C262 (≠ S232), G263 (≠ Y233), S264 (≠ G234), A266 (≠ S236), F271 (vs. gap), D331 (= D300), I353 (= I321), R356 (= R324), K453 (= K421)
6hdxA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with r3-hib-amp (see paper)
33% identity, 97% coverage: 12:430/434 of query aligns to 29:462/474 of 6hdxA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (2~{R})-2-methyl-3-oxidanyl-propanoate: Y162 (≠ F137), G164 (= G139), S237 (≠ G209), G238 (≠ A210), E239 (= E211), P240 (= P212), C262 (≠ S232), G263 (≠ Y233), S264 (≠ G234), A266 (≠ S236), F271 (vs. gap), D331 (= D300), I353 (= I321), R356 (= R324), K453 (= K421)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: Y162 (≠ F137), G164 (= G139), S237 (≠ G209), G263 (≠ Y233), S264 (≠ G234), A266 (≠ S236), F271 (vs. gap)
6sixB Paak family amp-ligase with anp (see paper)
31% identity, 88% coverage: 10:392/434 of query aligns to 12:389/437 of 6sixB
- binding phosphoaminophosphonic acid-adenylate ester: S88 (= S89), S89 (= S90), A213 (= A210), E214 (= E211), P215 (= P212), E236 (≠ S232), Y237 (= Y233), G238 (= G234), S239 (≠ L235), T240 (≠ S236), E241 (= E237), D300 (= D300), V320 (≠ I321), R323 (= R324)
- binding magnesium ion: R79 (≠ K80), E80 (≠ S81), P121 (≠ R124), T150 (≠ L153)
- binding zinc ion: C249 (= C247), H255 (= H254), C309 (= C309), C311 (= C311)
6siwA Paak family amp-ligase with amp (see paper)
31% identity, 88% coverage: 10:392/434 of query aligns to 7:384/432 of 6siwA
- binding adenosine monophosphate: S84 (= S90), A208 (= A210), E209 (= E211), P210 (= P212), E231 (≠ S232), Y232 (= Y233), G233 (= G234), S234 (≠ L235), T235 (≠ S236), D295 (= D300), V315 (≠ I321)
- binding magnesium ion: E75 (≠ S81), L77 (= L83), S83 (= S89), P116 (≠ R124), G143 (= G151), T145 (≠ L153), E236 (= E237)
- binding zinc ion: C244 (= C247), H250 (= H254), C304 (= C309), C306 (= C311)
6siyA Paak family amp-ligase with amp and substrate (see paper)
31% identity, 88% coverage: 10:392/434 of query aligns to 8:385/433 of 6siyA
- binding 3-hydroxyanthranilic acid: T125 (≠ A132), P126 (≠ G133), T132 (= T138), L135 (= L141), R153 (≠ G160), N177 (≠ I180), A209 (= A210), E232 (≠ S232), G234 (= G234), S235 (≠ L235)
- binding adenosine monophosphate: S85 (= S90), A209 (= A210), E210 (= E211), P211 (= P212), E232 (≠ S232), Y233 (= Y233), G234 (= G234), S235 (≠ L235), T236 (≠ S236), D296 (= D300), V316 (≠ I321)
- binding magnesium ion: R75 (≠ K80), E76 (≠ S81), L78 (= L83), P117 (≠ R124), G144 (= G151), A145 (≠ C152), T146 (≠ L153)
P40806 Polyketide synthase PksJ; PKS from Bacillus subtilis (strain 168) (see paper)
25% identity, 79% coverage: 82:426/434 of query aligns to 188:553/5043 of P40806
Sites not aligning to the query:
- 1689 modified: O-(pantetheine 4'-phosphoryl)serine
Q9S725 4-coumarate--CoA ligase 2; 4CL 2; 4-coumarate--CoA ligase isoform 2; At4CL2; 4-coumaroyl-CoA synthase 2; Caffeate--CoA ligase; EC 6.2.1.12; EC 6.2.1.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
23% identity, 81% coverage: 82:433/434 of query aligns to 196:551/556 of Q9S725
- K211 (≠ T97) mutation to S: Drastically reduces the activity.
- M293 (≠ H178) mutation M->A,P: Affects the substrate specificity.
- K320 (≠ L207) mutation K->L,A: Affects the substrate specificity.
- E401 (= E280) mutation to Q: Slighlty reduces the substrate specificity.
- C403 (= C287) mutation to A: Significantly reduces the substrate specificity.
- R449 (vs. gap) mutation to Q: Drastically reduces the activity.
- K457 (= K332) mutation to S: Drastically reduces the activity.
- K540 (= K421) mutation to N: Abolishes the activity.
3pbkA Structural and functional studies of fatty acyl-adenylate ligases from e. Coli and l. Pneumophila (see paper)
30% identity, 24% coverage: 321:426/434 of query aligns to 443:543/555 of 3pbkA
Sites not aligning to the query:
- active site: 171, 191, 216, 327, 328
- binding 5'-O-[(S)-(dodecanoyloxy)(hydroxy)phosphoryl]adenosine: 217, 222, 295, 296, 297, 323, 324, 325, 326, 327, 331, 432
4gxqA Crystal structure of atp bound rpmatb-bxbclm chimera b1 (see paper)
23% identity, 53% coverage: 203:430/434 of query aligns to 270:499/506 of 4gxqA
- active site: T303 (≠ S236), E304 (= E237), I403 (= I330), N408 (= N335), A491 (= A422)
- binding adenosine-5'-triphosphate: S277 (≠ A210), A278 (≠ E211), P279 (= P212), E298 (≠ N231), M302 (≠ L235), T303 (≠ S236), D382 (≠ E308), R397 (= R324)
- binding carbonate ion: S277 (≠ A210), R299 (≠ S232), G301 (= G234)
Sites not aligning to the query:
6e8oA Crystal structure of aryl acid adenylating enzyme fscc from fuscachelin nrps in complex with amp
24% identity, 67% coverage: 61:351/434 of query aligns to 160:458/536 of 6e8oA
- active site: S190 (= S89), S210 (vs. gap), H234 (≠ Q129), A336 (≠ S236), E337 (= E237), N437 (≠ I330), K442 (≠ N335)
- binding adenosine monophosphate: H234 (≠ Q129), G310 (≠ A210), A311 (≠ E211), K312 (≠ P212), V332 (≠ S232), F333 (≠ Y233), G334 (= G234), M335 (≠ L235), A336 (≠ S236), D416 (= D300), V428 (≠ I321), K442 (≠ N335)
Sites not aligning to the query:
6e97B Crystal structure of the aryl acid adenylating enzyme fscc from fuscachelin nrps in complex with dhb-adenylate
24% identity, 67% coverage: 61:351/434 of query aligns to 160:458/537 of 6e97B
- active site: S190 (= S89), S210 (vs. gap), H234 (≠ Q129), A336 (≠ S236), E337 (= E237), N437 (≠ I330), K442 (≠ N335)
- binding 5'-O-[(S)-[(2,3-dihydroxybenzene-1-carbonyl)oxy](hydroxy)phosphoryl]adenosine: H234 (≠ Q129), N235 (= N130), F236 (vs. gap), S240 (≠ G133), G310 (≠ A210), A311 (≠ E211), K312 (≠ P212), V332 (≠ S232), F333 (≠ Y233), G334 (= G234), M335 (≠ L235), A336 (≠ S236), D416 (= D300), K433 (≠ D326), K442 (≠ N335)
Sites not aligning to the query:
Query Sequence
>8500403 FitnessBrowser__Miya:8500403
MEFFDIAETWSREAIAAAQIVRLRNTVEQAMKSPFYGQRLKEAGVTPGSIRSLDDVRRIP
LTSKDDLRAQYPDGLICVPKSELVRMHASSGTTGTPTVVYHTQSDLNSWADLMARCMHMV
GIRREDVFQNMAGYGLFTGGLGIHYGAERLGCLTIPAGAGNTRRQVKLVRDFRTTVAHII
PSYALYLGAALRDEGEDPAGLPLRIALIGAEPHTEEARRRIEDMLGLKAYNSYGLSEMNG
PGVAFECVHQNGLHVWEDAYIAEIIDPATGEAVPDGEVGELVMTTLCRQGMPVLRYRTRD
LTRFLPGECPCGRVHRRLDRILGRADDMLIVKGVNIYPMQVEQVLMGFPEVGQNYLIVLE
RDDFRDVLRVKVEIRDEYFEEDMRKLHGLRERITRRIHDEILVTPKVDLVQHNSLPKSEG
KAQRVQDLRERPAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory