Comparing 8500594 DvMF_1342 ABC transporter related (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
64% identity, 100% coverage: 2:243/243 of query aligns to 1:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
64% identity, 100% coverage: 2:243/243 of query aligns to 1:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
64% identity, 100% coverage: 2:243/243 of query aligns to 1:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
64% identity, 100% coverage: 2:243/243 of query aligns to 1:242/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
64% identity, 100% coverage: 1:243/243 of query aligns to 2:240/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
62% identity, 100% coverage: 1:243/243 of query aligns to 1:240/240 of 4ymuJ
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
54% identity, 91% coverage: 20:239/243 of query aligns to 18:249/258 of 1b0uA
Sites not aligning to the query:
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
54% identity, 91% coverage: 20:239/243 of query aligns to 22:253/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 100% coverage: 1:243/243 of query aligns to 1:245/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 100% coverage: 1:243/243 of query aligns to 2:246/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 100% coverage: 1:243/243 of query aligns to 2:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 100% coverage: 1:243/243 of query aligns to 2:246/344 of 3tuiC
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
38% identity, 82% coverage: 19:218/243 of query aligns to 19:218/229 of 6z67B
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
38% identity, 82% coverage: 19:218/243 of query aligns to 19:218/230 of 6z4wA
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
40% identity, 89% coverage: 24:239/243 of query aligns to 46:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
40% identity, 89% coverage: 24:239/243 of query aligns to 46:263/382 of 7aheC
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
42% identity, 89% coverage: 1:217/243 of query aligns to 1:223/232 of 1f3oA
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
36% identity, 95% coverage: 10:240/243 of query aligns to 18:253/257 of P0AAH0
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
41% identity, 89% coverage: 1:217/243 of query aligns to 1:223/230 of 1l2tA
7ahdC Opua (e190q) occluded (see paper)
39% identity, 88% coverage: 23:236/243 of query aligns to 45:260/260 of 7ahdC
Sites not aligning to the query:
>8500594 DvMF_1342 ABC transporter related (RefSeq)
MINATNVHKFFYTPDKLHALRGVSLSVAPGEVVVIIGPSGSGKSTFLRCLNRLEYADEGA
IRIEGRDILDPDCEINEVRAEVGMVFQSFNLFPHLTVLENLTLAQTTVRKRGKAEAEKKG
MELLRKVGIAEKHNVYPDQLSGGQQQRVAIARALAMDPKAMLFDEPTSALDPEMVGEVLD
VMKNLAREGMTMVVVTHEMGFAREVADRVVFMDQGSILEVGSPDKFFTAPEHDRTKLFLS
QIL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory