Comparing 8500629 FitnessBrowser__Miya:8500629 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
41% identity, 92% coverage: 26:390/395 of query aligns to 1:365/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
41% identity, 92% coverage: 28:390/395 of query aligns to 1:363/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
37% identity, 92% coverage: 28:390/395 of query aligns to 1:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
37% identity, 92% coverage: 28:390/395 of query aligns to 1:321/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
30% identity, 62% coverage: 30:273/395 of query aligns to 1:231/241 of 2akoA
8j0gB Gk monomer complexes with glutamate and atp
33% identity, 66% coverage: 24:283/395 of query aligns to 1:271/274 of 8j0gB
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
32% identity, 65% coverage: 22:278/395 of query aligns to 5:255/258 of 7wx3B
8j0eB Gk monomer complexes with catalytic intermediate
33% identity, 67% coverage: 21:283/395 of query aligns to 1:266/269 of 8j0eB
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
36% identity, 47% coverage: 22:206/395 of query aligns to 5:185/236 of 7f5xA
8j0fA Gk tetramer with adjacent hooks at reaction state
32% identity, 67% coverage: 21:283/395 of query aligns to 2:265/270 of 8j0fA
>8500629 FitnessBrowser__Miya:8500629
MSGRNEARQDQADTTGDWQAERRRALADARCVVVKVGSAVLTNGEGLDLAMVESLAGQLS
AVQEGGRRVVLVSSGAVAAGRGVLRSCCEIAGMPHRQAASAIGQSRLMHHYDEAFARCGR
ISAQVLLTRDDLKSRNRFLNARNTFAALLDWGAIPVVNENDTVAVHDLKFGDNDCLASLL
LNIVEADLFVNMTSAGGVFAENPQDNPDACVMACIDDVHGLDLNGLCGGKTSVGTGGMYS
KLLSARRAAQIGVPTLIVPGREPDVLARVFAGEAIGTWVRADARTVSRRKYWLAYQSDPA
GTVTVDEGAARALLQGGKSLLPGGVCAVEGGFGSGALVRVAAQDGTVIGVGLSNYAAAEL
RRIMGHKRHEVAAILGDAHYPEVIHRDNLLLDAVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory