SitesBLAST
Comparing 8500633 FitnessBrowser__Miya:8500633 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P61887 Glucose-1-phosphate thymidylyltransferase 2; G1P-TT 2; dTDP-glucose pyrophosphorylase 2; dTDP-glucose synthase 2; EC 2.7.7.24 from Escherichia coli (strain K12) (see paper)
62% identity, 100% coverage: 1:291/292 of query aligns to 1:291/293 of P61887
- D108 (= D108) binding
- D223 (= D223) binding
1mc3A Crystal structure of rffh (see paper)
62% identity, 99% coverage: 1:289/292 of query aligns to 2:290/291 of 1mc3A
- binding magnesium ion: D109 (= D108), D224 (= D223)
- binding thymidine-5'-triphosphate: L7 (= L6), G9 (= G8), G10 (= G9), G12 (= G11), T13 (= T12), R14 (= R13), K24 (= K23), Q25 (= Q24), Q81 (= Q80), P84 (= P83), L87 (= L86), D109 (= D108)
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
61% identity, 98% coverage: 2:288/292 of query aligns to 4:290/290 of 1h5tA
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L8 (= L6), G10 (= G8), Q82 (= Q80), P85 (= P83), G87 (= G85), L108 (= L106), D110 (= D108), Y145 (= Y143), G146 (= G144), E161 (= E159), K162 (= K160), V172 (= V170), R194 (= R192)
- binding thymidine-5'-diphosphate: Y114 (= Y112), G115 (= G113), H116 (≠ D114), D117 (≠ R115), R219 (= R217), G220 (= G218), V250 (≠ I248), S251 (≠ A249)
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
61% identity, 98% coverage: 2:288/292 of query aligns to 4:290/290 of 1h5rA
- binding 1-O-phosphono-alpha-D-glucopyranose: L88 (= L86), Y145 (= Y143), G146 (= G144), E161 (= E159), K162 (= K160), V172 (= V170)
- binding thymidine: L8 (= L6), G10 (= G8), G11 (= G9), Q82 (= Q80), P85 (= P83), G87 (= G85), L88 (= L86), D110 (= D108), Y114 (= Y112), G115 (= G113), V250 (≠ I248), S251 (≠ A249), E255 (= E253), I256 (= I254)
1h5sB Thymidylyltransferase complexed with tmp (see paper)
61% identity, 98% coverage: 2:288/292 of query aligns to 5:291/291 of 1h5sB
- binding thymidine-5'-phosphate: L9 (= L6), G11 (= G8), G12 (= G9), Q83 (= Q80), P86 (= P83), D87 (≠ E84), G88 (= G85), D111 (= D108), Y115 (= Y112), G116 (= G113), H117 (≠ D114), D118 (≠ R115), G219 (= G216), R220 (= R217), G221 (= G218), S252 (≠ A249), E256 (= E253), I257 (= I254), R260 (= R257)
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
61% identity, 98% coverage: 1:285/292 of query aligns to 1:285/288 of 4ho6A
- binding uridine-5'-diphosphate-glucose: L6 (= L6), G8 (= G8), G9 (= G9), Q80 (= Q80), P83 (= P83), G85 (= G85), D108 (= D108), G144 (= G144), E159 (= E159), K160 (= K160), V170 (= V170), R192 (= R192)
- binding uridine 5'-triphosphate: L43 (= L43), Y112 (= Y112), G113 (= G113), H114 (≠ D114), G115 (≠ R115), T117 (≠ P117), E253 (= E253), I254 (= I254)
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
61% identity, 98% coverage: 1:285/292 of query aligns to 1:285/288 of 4ho5A
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L6 (= L6), G8 (= G8), G9 (= G9), Q24 (= Q24), Q80 (= Q80), P83 (= P83), G85 (= G85), L86 (= L86), L106 (= L106), D108 (= D108), Y112 (= Y112), G113 (= G113), H114 (≠ D114), G115 (≠ R115), F116 (≠ L116), T117 (≠ P117), F143 (≠ Y143), G144 (= G144), E159 (= E159), K160 (= K160), V170 (= V170), G216 (= G216), R217 (= R217), G218 (= G218), W221 (= W221), E253 (= E253), I254 (= I254)
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
61% identity, 98% coverage: 1:285/292 of query aligns to 1:285/288 of 4ho3A
- binding thymidine-5'-triphosphate: L6 (= L6), G8 (= G8), G9 (= G9), G11 (= G11), T12 (= T12), R13 (= R13), Q24 (= Q24), L43 (= L43), Q80 (= Q80), P83 (= P83), G85 (= G85), L86 (= L86), D108 (= D108), Y112 (= Y112), G113 (= G113), H114 (≠ D114), G115 (≠ R115), F116 (≠ L116), T117 (≠ P117), E194 (= E194), E253 (= E253), I254 (= I254), R257 (= R257)
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
61% identity, 98% coverage: 1:285/292 of query aligns to 1:285/289 of 4ho4A
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
61% identity, 98% coverage: 1:285/292 of query aligns to 1:285/294 of 4ho9A
- binding galactose-uridine-5'-diphosphate: L6 (= L6), G8 (= G8), G9 (= G9), Q80 (= Q80), P83 (= P83), G85 (= G85), L86 (= L86), L106 (= L106), D108 (= D108), G144 (= G144), E159 (= E159), K160 (= K160), V170 (= V170), R192 (= R192), W221 (= W221)
- binding uridine 5'-triphosphate: L43 (= L43), G113 (= G113), H114 (≠ D114), G115 (≠ R115), T117 (≠ P117), G216 (= G216), R217 (= R217), G218 (= G218), I254 (= I254)
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
59% identity, 98% coverage: 2:287/292 of query aligns to 5:290/292 of P26393
- T201 (= T198) mutation to A: Two-fold increase in the conversion of 2-acetamido-2-deoxy-alpha-D-glucopyranosyl phosphate.
- W224 (= W221) mutation to H: Is able to convert both 6-acetamido-6-deoxy-alpha-D-glucopyranosyl phosphate and alpha-D-glucopyranuronic acid 1-(dihydrogen phosphate), which are not accepted by the wild-type.
1iinA Thymidylyltransferase complexed with udp-glucose (see paper)
59% identity, 98% coverage: 2:286/292 of query aligns to 5:289/289 of 1iinA
- binding uridine-5'-diphosphate-glucose: L9 (= L6), G11 (= G8), G12 (= G9), R16 (= R13), Q83 (= Q80), P86 (= P83), D87 (≠ E84), G88 (= G85), L89 (= L86), L109 (= L106), D111 (= D108), Y146 (= Y143), G147 (= G144), E162 (= E159), K163 (= K160), V173 (= V170), R195 (= R192), W224 (= W221)
1iimA Thymidylyltransferase complexed with ttp (see paper)
59% identity, 98% coverage: 2:286/292 of query aligns to 5:289/289 of 1iimA
- binding thymidine-5'-triphosphate: L9 (= L6), G11 (= G8), G12 (= G9), S13 (= S10), G14 (= G11), T15 (= T12), R16 (= R13), Q27 (= Q24), Q83 (= Q80), P86 (= P83), G88 (= G85), L89 (= L86), D111 (= D108), Y115 (= Y112), G116 (= G113), H117 (≠ D114), P120 (= P117), G219 (= G216), R220 (= R217), G221 (= G218), S252 (≠ A249), E256 (= E253), I257 (= I254)
3pkpA Q83s variant of s. Enterica rmla with datp (see paper)
59% identity, 98% coverage: 2:287/292 of query aligns to 5:290/290 of 3pkpA
- binding 2'-deoxyadenosine 5'-triphosphate: G11 (= G8), G12 (= G9), S13 (= S10), G14 (= G11), T15 (= T12), R16 (= R13), K26 (= K23), Q27 (= Q24), S83 (≠ Q80), P86 (= P83), G110 (= G107), D111 (= D108)
3pkpB Q83s variant of s. Enterica rmla with datp (see paper)
59% identity, 98% coverage: 2:287/292 of query aligns to 4:289/289 of 3pkpB
- binding 2'-deoxyadenosine 5'-triphosphate: G10 (= G8), G11 (= G9), S12 (= S10), G13 (= G11), T14 (= T12), R15 (= R13), K25 (= K23), Q26 (= Q24), S82 (≠ Q80), P85 (= P83), G109 (= G107), D110 (= D108)
- binding magnesium ion: D110 (= D108), D225 (= D223)
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
60% identity, 99% coverage: 2:290/292 of query aligns to 3:291/293 of 5ifyA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L7 (= L6), G9 (= G8), Q81 (= Q80), P84 (= P83), G86 (= G85), L87 (= L86), D109 (= D108), Y144 (= Y143), G145 (= G144), E160 (= E159), K161 (= K160), V171 (= V170), Y175 (= Y174), R193 (= R192)
- binding 2'-deoxyuridine 5'-monophosphate: Y113 (= Y112), G114 (= G113), H115 (≠ D114), D116 (≠ R115), G217 (= G216), R218 (= R217), G219 (= G218), E254 (= E253), I255 (= I254)
4hocA Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-n- acetylglucosamine
61% identity, 98% coverage: 1:285/292 of query aligns to 1:283/286 of 4hocA
- binding uridine-diphosphate-n-acetylglucosamine: L6 (= L6), G8 (= G8), G9 (= G9), Q80 (= Q80), P83 (= P83), G85 (= G85), L86 (= L86), D108 (= D108), G144 (= G144), E159 (= E159), K160 (= K160), V170 (= V170)
3pkqA Q83d variant of s. Enterica rmla with dgtp (see paper)
59% identity, 98% coverage: 2:287/292 of query aligns to 3:285/285 of 3pkqA
- binding 2'-deoxyguanosine-5'-triphosphate: L7 (= L6), G9 (= G8), G10 (= G9), S11 (= S10), G12 (= G11), T13 (= T12), R14 (= R13), Q25 (= Q24), D81 (≠ Q80), S83 (≠ R82), L107 (= L106), G108 (= G107), D109 (= D108)
- binding magnesium ion: D109 (= D108), D221 (= D223)
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
60% identity, 99% coverage: 2:290/292 of query aligns to 13:301/302 of 4b2xB
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
60% identity, 99% coverage: 2:290/292 of query aligns to 9:297/298 of 5fuhA
- binding N-[6-amino-1-(3-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl]-N-methylbenzenesulfonamide: T47 (≠ V40), L50 (= L43), Y118 (≠ F111), G120 (= G113), F123 (≠ L116), A256 (= A249), R264 (= R257), Q265 (≠ K258)
Query Sequence
>8500633 FitnessBrowser__Miya:8500633
MKGIILAGGSGTRLYPITMGVSKQLMPVYDKPMIYYPLSVLMLAGIREICIITTPADQPR
FRELLGEGSQLGLSFTYIEQPRPEGLAQAFLLARDFLAGEPSCLILGDNLFYGDRLPSLL
RQCAKLEKGGVVFGYKVRDPERYGVVEFDAACKVISIEEKPAAPKSRFAVTGLYFYDGRA
PELAARLAPSPRGELEITDLNNLYLREGNLSVEFLGRGVAWLDTGTFESLHQAASFVRAV
QDRQGLKIACIEEIAWRKGYIDDDALRALAAPMLKNDYGRYLMDIMEDRLRV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory