SitesBLAST
Comparing 8500725 FitnessBrowser__Miya:8500725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P12047 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; Glutamyl--tRNA ligase regulatory factor; EC 4.3.2.2 from Bacillus subtilis (strain 168) (see paper)
55% identity, 99% coverage: 1:428/432 of query aligns to 1:428/431 of P12047
- H89 (= H89) mutation to Q: Abolishes enzyme activity.
- H141 (= H141) mutation to Q: Abolishes enzyme activity.
- Q212 (= Q212) mutation to E: Decreases catalytic activity 1000-fold.; mutation to M: Abolishes enzyme activity.
- N270 (= N270) mutation N->D,L: Abolishes enzyme activity.
- R301 (= R301) mutation R->K,Q: Abolishes enzyme activity.
2x75A Staphylococcus aureus adenylosuccinate lyase (see paper)
51% identity, 99% coverage: 2:427/432 of query aligns to 1:423/427 of 2x75A
Q9X0I0 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
48% identity, 99% coverage: 1:427/432 of query aligns to 1:427/431 of Q9X0I0
- H141 (= H141) active site, Proton donor/acceptor
4eeiB Crystal structure of adenylosuccinate lyase from francisella tularensis complexed with amp and succinate
38% identity, 99% coverage: 1:427/432 of query aligns to 1:413/423 of 4eeiB
- active site: H67 (= H68), S140 (≠ T140), H141 (= H141), K256 (= K268), E263 (= E275)
- binding adenosine monophosphate: K66 (≠ R67), H67 (= H68), D68 (= D69), Q212 (= Q212), R289 (= R301), I291 (= I303), S294 (= S306), R298 (= R310)
5hw2A Crystal structure of adenylosuccinate lyase from francisella tularensis complexed with fumaric acid
38% identity, 98% coverage: 1:423/432 of query aligns to 1:418/419 of 5hw2A
Q05911 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 88% coverage: 4:382/432 of query aligns to 14:407/482 of Q05911
- K196 (≠ S181) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
5nx9D Crystal structure of neanderthal adenylosuccinate lyase (adsl) in complex with its products amp and fumarate (see paper)
26% identity, 97% coverage: 1:417/432 of query aligns to 10:442/477 of 5nx9D
- active site: H79 (= H68), T151 (= T140), H152 (= H141), S283 (= S263), K288 (= K268), E295 (= E275)
- binding 2-[9-(3,4-dihydroxy-5-phosphonooxymethyl-tetrahydro-furan-2-yl)-9h-purin-6-ylamino]-succinic acid: T151 (= T140), H152 (= H141)
- binding adenosine monophosphate: R13 (= R4), Y14 (= Y5), R78 (= R67), H79 (= H68), D80 (= D69), S105 (= S94), Q234 (= Q212), R296 (≠ N276), L324 (≠ I303), S327 (= S306), A328 (≠ S307), R331 (= R310)
- binding fumaric acid: H79 (= H68), S105 (= S94), Q234 (= Q212), S282 (= S262), S283 (= S263), K288 (= K268)
P30566 Adenylosuccinate lyase; ADSL; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Homo sapiens (Human) (see 13 papers)
26% identity, 97% coverage: 1:417/432 of query aligns to 17:449/484 of P30566
- M26 (= M10) to L: in ADSLD; severe; dbSNP:rs1311171245
- I72 (≠ A52) to V: in ADSLD; severe
- P100 (≠ G82) to A: in ADSLD; moderate; dbSNP:rs119450942
- Y114 (≠ D96) to H: in ADSLD; severe; total loss of activity; dbSNP:rs374259530
- R141 (≠ T123) to W: in ADSLD; severe; dbSNP:rs756210458
- H159 (= H141) active site, Proton donor/acceptor
- R190 (≠ L172) to Q: in ADSLD; moderate; dbSNP:rs28941471
- R194 (= R176) to C: in ADSLD; severe; reduces protein stability; dbSNP:rs1465152683
- K246 (≠ D217) to E: in ADSLD; moderate; strongly reduced catalytic activity; dbSNP:rs119450944
- D268 (≠ E239) to N: in ADSLD; severe; total loss of activity; dbSNP:rs746501563
- S289 (= S262) active site, Proton donor/acceptor
- R303 (≠ N276) to C: in ADSLD; mild; strongly reduced activity with SAMP, but only slightly reduced activity with SAICAR; abolishes cooperativity; dbSNP:rs373458753
- L311 (≠ I284) to V: in ADSLD; severe; slightly reduced enzyme activity
- P318 (≠ A291) to L: in ADSLD; severe; dbSNP:rs202064195
- V364 (= V336) to M: in ADSLD; severe; dbSNP:rs370851726
- R374 (≠ A346) to W: in ADSLD; severe; dbSNP:rs376533026
- S395 (≠ A367) to R: in ADSLD; severe
- R396 (= R368) to C: in ADSLD; severe; abolishes cooperativity and reduces enzyme activity; dbSNP:rs755492501; to H: in ADSLD; severe; abolishes cooperativity and reduces enzyme activity; dbSNP:rs763542069
- D422 (= D391) to Y: in ADSLD; moderate; dbSNP:rs119450943
- L423 (≠ M392) to V: in ADSLD; moderate
- R426 (≠ A395) to H: in ADSLD; severe; most frequent mutation; dbSNP:rs119450941
- D430 (≠ S400) to N: in ADSLD; mild; dbSNP:rs554254383
- S438 (= S406) to P: in ADSLD; severe; dbSNP:rs119450940
- S447 (≠ G415) to P: in ADSLD; severe; dbSNP:rs777821034
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine; A → V: in ADSLD; severe; dbSNP:rs143083947
- 3 A → V: in ADSLD; severe
- 450 T → S: in ADSLD; moderate; dbSNP:rs372895468
- 452 R → P: in ADSLD; severe
5vkwB Crystal structure of adenylosuccinate lyase ade13 from candida albicans
26% identity, 96% coverage: 4:418/432 of query aligns to 14:440/469 of 5vkwB
5nxaA Crystal structure of neanderthal adenylosuccinate lyase (adsl)in complex with its products aicar and fumarate (see paper)
24% identity, 97% coverage: 1:417/432 of query aligns to 10:429/464 of 5nxaA
- active site: H79 (= H68), T151 (= T140), H152 (= H141), K275 (= K268), E282 (= E275)
- binding n-{[5-amino-1-(5-o-phosphono-beta-d-arabinofuranosyl)-1h-imidazol-4-yl]carbonyl}-l-aspartic acid: R13 (= R4), Y14 (= Y5), R78 (= R67), H79 (= H68), D80 (= D69), T104 (= T93), S105 (= S94), Q234 (= Q212), K275 (= K268), R283 (≠ N276), L311 (≠ I303), S314 (= S306), A315 (≠ S307), R318 (= R310)
5eytA Crystal structure of adenylosuccinate lyase from schistosoma mansoni in complex with amp (see paper)
25% identity, 97% coverage: 1:417/432 of query aligns to 9:421/472 of 5eytA
5nxaB Crystal structure of neanderthal adenylosuccinate lyase (adsl)in complex with its products aicar and fumarate (see paper)
25% identity, 77% coverage: 87:417/432 of query aligns to 36:380/415 of 5nxaB
- active site: T89 (= T140), H90 (= H141), S221 (= S263), K226 (= K268), E233 (= E275)
- binding aminoimidazole 4-carboxamide ribonucleotide: M230 (≠ I272), R234 (≠ N276)
- binding fumaric acid: S220 (= S262), S221 (= S263), M223 (= M265), K226 (= K268), N228 (= N270)
- binding n-{[5-amino-1-(5-o-phosphono-beta-d-arabinofuranosyl)-1h-imidazol-4-yl]carbonyl}-l-aspartic acid: S43 (= S94), T89 (= T140), H90 (= H141), Q172 (= Q212), L262 (≠ I303), S265 (= S306), A266 (≠ S307), R269 (= R310)
Sites not aligning to the query:
A0A0K2JL82 Nitrosuccinate lyase; EC 4.3.99.5 from Streptomyces cremeus (see paper)
29% identity, 95% coverage: 20:431/432 of query aligns to 42:470/476 of A0A0K2JL82
- N93 (vs. gap) mutation to A: Slight decrease in activity.
- D125 (= D96) mutation D->N,V: Almost loss of activity.
- R137 (≠ Q108) binding
- R140 (≠ E111) binding
- R201 (= R169) binding
- H253 (≠ V213) mutation to A: Loss of activity.
- S302 (= S262) mutation to A: Loss of activity.
- K308 (= K268) binding ; mutation to A: Loss of activity.
- N310 (= N270) binding ; mutation to A: Loss of activity.
- R341 (≠ I303) mutation to A: Loss of activity.
5nxaC Crystal structure of neanderthal adenylosuccinate lyase (adsl)in complex with its products aicar and fumarate (see paper)
24% identity, 83% coverage: 4:363/432 of query aligns to 12:372/418 of 5nxaC
- active site: H78 (= H68), T150 (= T140), H151 (= H141), K276 (= K268), E283 (= E275)
- binding aminoimidazole 4-carboxamide ribonucleotide: R77 (= R67), H78 (= H68), D79 (= D69), Q233 (= Q212), L312 (≠ I303), S315 (= S306), A316 (≠ S307), R319 (= R310)
- binding fumaric acid: H78 (= H68), T103 (= T93), S104 (= S94), Q233 (= Q212)
- binding n-{[5-amino-1-(5-o-phosphono-beta-d-arabinofuranosyl)-1h-imidazol-4-yl]carbonyl}-l-aspartic acid: R12 (= R4), Y13 (= Y5), T150 (= T140), H151 (= H141), K276 (= K268), R284 (≠ N276)
5nx9C Crystal structure of neanderthal adenylosuccinate lyase (adsl) in complex with its products amp and fumarate (see paper)
24% identity, 96% coverage: 4:417/432 of query aligns to 12:418/441 of 5nx9C
- active site: H78 (= H68), T150 (= T140), H151 (= H141), E280 (= E275)
- binding 2-[9-(3,4-dihydroxy-5-phosphonooxymethyl-tetrahydro-furan-2-yl)-9h-purin-6-ylamino]-succinic acid: R12 (= R4), Y13 (= Y5), R77 (= R67), H78 (= H68), D79 (= D69), T103 (= T93), S104 (= S94), Q233 (= Q212), M277 (≠ I272), R281 (≠ N276), L309 (≠ I303), S312 (= S306), A313 (≠ S307), R316 (= R310)
- binding fumaric acid: T150 (= T140), H151 (= H141)
2qgaC Plasmodium vivax adenylosuccinate lyase pv003765 with amp bound
31% identity, 68% coverage: 52:344/432 of query aligns to 70:374/455 of 2qgaC
P0AB89 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 59% coverage: 55:310/432 of query aligns to 78:344/456 of P0AB89
- NHD 90:92 (≠ RHD 67:69) binding ; binding
- H91 (= H68) binding
- K94 (≠ I71) modified: N6-acetyllysine
- TS 122:123 (= TS 93:94) binding ; binding
- H171 (= H141) mutation H->A,N: Reduces catalytic activity about 500-fold.
- Q247 (= Q212) binding ; binding ; binding
- S295 (= S262) mutation to A: Reduces catalytic activity about 1000-fold.
- S296 (= S263) binding ; binding
- KVN 301:303 (≠ KKN 268:270) binding ; binding
- N309 (= N276) binding ; binding
- R335 (= R301) binding ; binding
- STVLR 340:344 (≠ SSVER 306:310) binding ; binding
Sites not aligning to the query:
- 15:16 binding ; binding
- 366 modified: N6-acetyllysine
3gzhA Crystal structure of phosphate-bound adenylosuccinate lyase from e. Coli (see paper)
31% identity, 59% coverage: 55:310/432 of query aligns to 91:357/469 of 3gzhA
- active site: H104 (= H68), T183 (= T140), H184 (= H141), S309 (= S263), K314 (= K268), E321 (= E275)
- binding phosphate ion: H104 (= H68), T135 (= T93), S136 (= S94), S353 (= S306), T354 (≠ S307), R357 (= R310)
2ptqA Crystal structure of escherichia coli adenylosuccinate lyase mutant h171n with bound amp and fumarate (see paper)
31% identity, 59% coverage: 55:310/432 of query aligns to 78:344/459 of 2ptqA
- active site: H91 (= H68), T170 (= T140), N171 (≠ H141), S296 (= S263), K301 (= K268), E308 (= E275)
- binding adenosine monophosphate: N90 (≠ R67), H91 (= H68), Q247 (= Q212), N309 (= N276), R335 (= R301), L337 (≠ I303), S340 (= S306), T341 (≠ S307), R344 (= R310)
- binding fumaric acid: H91 (= H68), T122 (= T93), S123 (= S94), Q247 (= Q212), S295 (= S262), S296 (= S263), M298 (= M265), K301 (= K268), N303 (= N270)
Sites not aligning to the query:
2ptrA Crystal structure of escherichia coli adenylosuccinate lyase mutant h171a with bound adenylosuccinate substrate (see paper)
31% identity, 59% coverage: 55:310/432 of query aligns to 78:344/454 of 2ptrA
- active site: H91 (= H68), T170 (= T140), A171 (≠ H141), K301 (= K268), E308 (= E275)
- binding 2-[9-(3,4-dihydroxy-5-phosphonooxymethyl-tetrahydro-furan-2-yl)-9h-purin-6-ylamino]-succinic acid: H91 (= H68), D92 (= D69), T122 (= T93), S123 (= S94), Q247 (= Q212), S295 (= S262), S296 (= S263), M298 (= M265), K301 (= K268), N303 (= N270), N309 (= N276), R335 (= R301), L337 (≠ I303), S340 (= S306), T341 (≠ S307), R344 (= R310)
Sites not aligning to the query:
Query Sequence
>8500725 FitnessBrowser__Miya:8500725
MIDRYSRPEMARIWTLENRFRAWLDVELAVCEAWHRLGVIGADDMRVIREKADFDVDRIL
EIEQETRHDVIAFLTAVEEKVGPSARFIHLGCTSSDIVDTANGLLLAQAGELILKGFERL
LSTLETLAFANKGRLCMGRTHGIHAEPTSFGLKMAGFHAEFQRHVARFRDGLESVRVGKI
SGAVGTYAMLDPRVEAIACEILGLAVDPISTQVIQRDRHAHFFTSLALAAGGVERLCVEL
RHLQRTEVLEAEEGFAKGQKGSSAMPHKKNPISAENMTGLSRLIRTNSLAAMENMALWHE
RDISHSSVERVIMPDSTILMDYVLHRLSGLLSNLRVIPENMDRNLAGSYGLYYSQRVLLA
LVESGMARQEAYVMVQRCAMQSWETRKPFPDMVRADADISARLAPSVLDELFDPGYYLRH
ENMIFDRVFGRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory