Comparing 8500757 FitnessBrowser__Miya:8500757 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 69% coverage: 17:250/337 of query aligns to 26:260/265 of P07821
6tejB Structure of apo irtab devoid sid in complex with sybody syb_nl5 (see paper)
37% identity, 67% coverage: 2:228/337 of query aligns to 331:554/585 of 6tejB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 67% coverage: 1:227/337 of query aligns to 2:225/241 of 4u00A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
35% identity, 64% coverage: 4:217/337 of query aligns to 9:217/223 of 2pclA
8hf7B Cryo-em structure of coma bound to its mature substrate csp peptide (see paper)
33% identity, 65% coverage: 4:221/337 of query aligns to 332:546/563 of 8hf7B
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 68% coverage: 1:229/337 of query aligns to 1:227/240 of 4ymuJ
8hf4A Cryo-em structure of nucleotide-bound coma at outward-facing state with ec gate closed conformation (see paper)
32% identity, 65% coverage: 4:221/337 of query aligns to 332:546/563 of 8hf4A
8k7aA Cryo-em structure of nucleotide-bound coma e647q mutant with mg2+
32% identity, 65% coverage: 4:221/337 of query aligns to 332:546/563 of 8k7aA
8hf6A Cryo-em structure of nucleotide-bound coma e647q mutant (see paper)
32% identity, 65% coverage: 4:221/337 of query aligns to 332:546/563 of 8hf6A
7mdyC Lolcde nucleotide-bound
36% identity, 60% coverage: 16:216/337 of query aligns to 20:220/226 of 7mdyC
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
36% identity, 60% coverage: 16:216/337 of query aligns to 23:223/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
36% identity, 60% coverage: 16:216/337 of query aligns to 20:220/222 of 7arlD
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 64% coverage: 18:233/337 of query aligns to 21:230/280 of 5x40A
Sites not aligning to the query:
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
32% identity, 65% coverage: 17:235/337 of query aligns to 17:233/240 of 6mjpA
3d31A Modbc from methanosarcina acetivorans (see paper)
32% identity, 68% coverage: 1:230/337 of query aligns to 1:220/348 of 3d31A
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
36% identity, 60% coverage: 16:216/337 of query aligns to 22:222/229 of 7v8iD
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
30% identity, 62% coverage: 14:221/337 of query aligns to 20:226/650 of 5ws4A
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
32% identity, 64% coverage: 1:214/337 of query aligns to 1:213/219 of 8w6iD
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
32% identity, 64% coverage: 1:216/337 of query aligns to 1:215/222 of P0A9R7
Q9DC29 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; EC 7.6.2.5 from Mus musculus (Mouse) (see paper)
31% identity, 70% coverage: 2:236/337 of query aligns to 590:823/842 of Q9DC29
Sites not aligning to the query:
>8500757 FitnessBrowser__Miya:8500757
MIEISRVHAGYGDTGDVLRDVSLSVPPGELVGLLGPNGSGKTTLLLVLSGVLAPRCGTVT
LDGAPLHRLRPRERARRIAAVPQRPEHIPDQDALSLVLMGRYPHTTLLRGYGPDDHAAAL
AALRDTGCAHLAARGARTLSGGELQRVLLARALAQGADTLLLDEATAGLDVARALDILDL
LHARHRAGARIVAAVHDLNLAALYCSRLIFLKHGRVVEDGPVEQAFTAAVLSEVYETPVT
VQPHPVTGTPQACYVPGAFRMDMRVGLPPNPMGAAQADPTKSKRSPYYHDAPLAEPALPL
SGFSGHAQPRPATPPARCGEPEISAQTAPLPTGTQDD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory