SitesBLAST
Comparing 8500826 FitnessBrowser__Miya:8500826 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
36% identity, 91% coverage: 43:471/474 of query aligns to 30:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P85), G75 (= G87), S76 (≠ G88), G77 (= G89), T78 (= T90), G79 (= G91), L80 (= L92), A83 (≠ G95), C84 (= C96), P137 (= P149), G138 (= G151), E139 (≠ M152), A142 (≠ S155), T143 (= T156), G146 (= G159), N147 (= N160), S149 (≠ A162), T150 (= T163), A152 (= A165), G153 (= G166), E203 (= E216), G204 (= G217), I209 (= I222), E422 (= E430), H423 (= H431)
- binding fe (iii) ion: H377 (= H388), H384 (= H395), E422 (= E430)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
37% identity, 91% coverage: 44:472/474 of query aligns to 26:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R339), W322 (≠ S343), H369 (= H388), H376 (= H395), H413 (= H431)
- binding flavin-adenine dinucleotide: E32 (≠ A50), P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W322 (≠ S343), E412 (= E430), H413 (= H431), N449 (= N467)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E412 (= E430)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
37% identity, 91% coverage: 44:472/474 of query aligns to 26:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R339), W322 (≠ S343), S336 (= S355), H369 (= H388), H376 (= H395), H413 (= H431)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), E412 (= E430), N449 (= N467)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E412 (= E430)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ A50), P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W323 (≠ S343), E414 (= E430), H415 (= H431), N451 (= N467)
- binding manganese (ii) ion: H370 (= H388), H377 (= H395), E414 (= E430)
- binding pyruvic acid: R319 (= R339), H370 (= H388), H377 (= H395), H415 (= H431)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
37% identity, 91% coverage: 44:472/474 of query aligns to 26:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ A50), P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W322 (≠ S343), E413 (= E430), H414 (= H431), N450 (= N467)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R339), H369 (= H388), H376 (= H395), H414 (= H431)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E413 (= E430)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R339), H369 (= H388), H376 (= H395), H414 (= H431)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W322 (≠ S343), E413 (= E430), H414 (= H431), N450 (= N467)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E413 (= E430)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W322 (≠ S343), E413 (= E430), H414 (= H431), N450 (= N467)
- binding lactic acid: R318 (= R339), H369 (= H388), H376 (= H395), H414 (= H431)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E413 (= E430)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L92), R317 (= R339), W321 (≠ S343), H368 (= H388), H375 (= H395), H413 (= H431)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W321 (≠ S343), Y322 (= Y349), E412 (= E430), H413 (= H431), N449 (= N467)
- binding manganese (ii) ion: H368 (= H388), H375 (= H395), E412 (= E430)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
37% identity, 91% coverage: 44:472/474 of query aligns to 26:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R339), W322 (≠ S343), H369 (= H388), H376 (= H395), H414 (= H431)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), W322 (≠ S343), E413 (= E430), N450 (= N467)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E413 (= E430)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), H369 (= H388), E413 (= E430), N450 (= N467)
- binding deaminohydroxyvaline: R319 (= R339), H414 (= H431)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
36% identity, 94% coverage: 27:471/474 of query aligns to 8:464/465 of 3pm9A
- active site: A149 (= A165), L159 (≠ V175)
- binding flavin-adenine dinucleotide: P69 (= P85), Q70 (≠ R86), G71 (= G87), G72 (= G88), N73 (≠ G89), T74 (= T90), G75 (= G91), L76 (= L92), G79 (= G95), Q80 (≠ C96), L91 (= L107), L133 (≠ P149), G134 (≠ A150), A135 (≠ G151), C139 (≠ S155), T140 (= T156), G142 (= G158), G143 (= G159), S146 (≠ A162), T147 (= T163), A149 (= A165), G150 (= G166), E200 (= E216), G201 (= G217), I205 (≠ V221), I206 (= I222), E423 (= E430)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), Y324 (= Y349), H370 (= H388), E414 (= E430), N451 (= N467)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R339), W323 (≠ S343), H415 (= H431)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R339), W323 (≠ S343), H370 (= H388), H415 (= H431)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), H370 (= H388), E414 (= E430), N451 (= N467)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R339), W323 (≠ S343), H415 (= H431)
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), Y324 (= Y349), H370 (= H388), E414 (= E430), N451 (= N467)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), H370 (= H388), E414 (= E430), N451 (= N467)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R339), W323 (≠ S343), H415 (= H431)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), H370 (= H388), E414 (= E430), N451 (= N467)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R339), H415 (= H431)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
36% identity, 91% coverage: 44:472/474 of query aligns to 26:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P85), G70 (= G87), T71 (≠ G88), G72 (= G89), T73 (= T90), G74 (= G91), G78 (= G95), V79 (≠ C96), L90 (= L107), P132 (= P149), G133 (= G151), A134 (≠ M152), G140 (= G159), M141 (≠ N160), A143 (= A162), T144 (= T163), A146 (= A165), S147 (≠ G166), E200 (= E216), G201 (= G217), I206 (= I222), Y324 (= Y349), H370 (= H388), E414 (= E430), N451 (= N467)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L92), R319 (= R339), W323 (≠ S343), H415 (= H431)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 87% coverage: 63:474/474 of query aligns to 46:458/459 of P9WIT1
- K354 (≠ E367) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 97% coverage: 11:470/474 of query aligns to 16:494/496 of P39976
- K17 (≠ T12) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
30% identity, 89% coverage: 53:472/474 of query aligns to 44:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (= P85), G78 (= G87), G79 (= G88), N80 (≠ G89), T81 (= T90), G82 (= G91), M83 (≠ L92), G86 (= G95), S87 (≠ C96), L140 (≠ P149), A142 (≠ G151), C146 (≠ S155), H147 (≠ T156), G150 (= G159), N151 (= N160), A153 (= A162), T154 (= T163), G208 (= G217), I212 (≠ V221), I213 (= I222), E423 (= E430), N460 (= N467)
Sites not aligning to the query:
Query Sequence
>8500826 FitnessBrowser__Miya:8500826
MPHTSDRSLPPTSDSAPRFVLTDAHRAAIVAAVGEAAVLHSPGEPYDRDASELRAPADLV
VLPETVEQVQALLRCASAHAIPVIPRGGGTGLAGGCLAVRGGVVLSLERMNRIRAIDTRN
LVAEVEAGVISQRVRDAAAEQGLYYPPDPAGMDRSTIGGNVATNAGGPACVKYGVTRDYV
LGVEAVLPDGELLRAGVRTRKGVVGYDMAHLLCGSEGTLGVITALTLKLVPLPPATVSMA
VAFPDMAAAMRGVAAVLGGGHLPSAIEFLDHRCIRLLGELLPIPVPGDKPSLLIIELDGA
REQIVPELDLVAAICRQQGATHVLPAADEETRVRVWGARRQVSLRIHDYAALYMSEDVAV
PLGAIAELVAALPEFEQRYGMEIFAFGHAGDGNIHLNVTAPTRDTRDVVEQGIVELVGKV
LELGGTISGEHGIGEAKKHLLPLELSPASIRLQRGIRQVFDPRGIMNPGKVFGQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory