Comparing 8500828 FitnessBrowser__Miya:8500828 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
51% identity, 92% coverage: 13:253/261 of query aligns to 1:239/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
48% identity, 92% coverage: 14:253/261 of query aligns to 1:239/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
48% identity, 92% coverage: 14:253/261 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
48% identity, 92% coverage: 14:253/261 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
48% identity, 92% coverage: 14:253/261 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
48% identity, 92% coverage: 14:253/261 of query aligns to 3:241/242 of 2oljA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
43% identity, 91% coverage: 15:251/261 of query aligns to 7:254/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
43% identity, 91% coverage: 15:251/261 of query aligns to 3:250/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 87% coverage: 14:239/261 of query aligns to 1:230/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 87% coverage: 14:239/261 of query aligns to 2:231/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 87% coverage: 14:239/261 of query aligns to 2:231/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
39% identity, 87% coverage: 14:239/261 of query aligns to 2:231/344 of 6cvlD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
41% identity, 83% coverage: 14:229/261 of query aligns to 3:217/223 of 2pclA
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
35% identity, 88% coverage: 14:242/261 of query aligns to 2:231/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
35% identity, 88% coverage: 14:242/261 of query aligns to 4:233/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
35% identity, 88% coverage: 14:242/261 of query aligns to 4:233/263 of 7d08B
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
36% identity, 83% coverage: 14:229/261 of query aligns to 1:216/222 of 8i6rB
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
34% identity, 83% coverage: 20:236/261 of query aligns to 10:225/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
34% identity, 83% coverage: 20:236/261 of query aligns to 10:225/229 of 6z67B
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
42% identity, 70% coverage: 28:209/261 of query aligns to 21:202/226 of 5xu1B
>8500828 FitnessBrowser__Miya:8500828
MATPESVTTSGTPILRLENIGKTLGGKRILSDISMDVDKGELKVLIGPSGAGKSTLLQCI
NYLIPPDEGHIRLEGRVVDAACKSELYAFRQQVGMIFQDFNLFDHLDALSNVSIALRKVR
GMSRKAAAERAMAELERVGLANRATLYPAQLSGGQKQRVAIARALAMDPKVMLLDEPTSA
LDPELVGEVLAVIRDLARGGMTMVMASHQMDFTRALAHEILFMERGRIIERGSPAELLAP
GSGTRTADFCSRLTDLCEECS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory