Comparing 8500830 FitnessBrowser__Miya:8500830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
38% identity, 86% coverage: 30:244/249 of query aligns to 9:223/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
37% identity, 86% coverage: 30:244/249 of query aligns to 9:221/225 of 4zv2A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
37% identity, 86% coverage: 30:244/249 of query aligns to 15:225/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
39% identity, 86% coverage: 30:244/249 of query aligns to 15:226/229 of 5t0wA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
33% identity, 89% coverage: 23:244/249 of query aligns to 11:237/246 of 4ohnA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
34% identity, 90% coverage: 25:247/249 of query aligns to 14:235/235 of 4g4pA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
32% identity, 98% coverage: 4:246/249 of query aligns to 1:253/260 of P02911
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
36% identity, 72% coverage: 23:201/249 of query aligns to 3:178/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
36% identity, 72% coverage: 23:201/249 of query aligns to 9:184/241 of 2q2aA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
36% identity, 71% coverage: 25:201/249 of query aligns to 1:174/231 of 2q2cA
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
32% identity, 87% coverage: 30:246/249 of query aligns to 6:228/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
32% identity, 87% coverage: 30:246/249 of query aligns to 9:231/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
32% identity, 87% coverage: 30:246/249 of query aligns to 9:231/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
32% identity, 87% coverage: 30:246/249 of query aligns to 9:231/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
32% identity, 87% coverage: 30:246/249 of query aligns to 9:231/238 of 1lafE
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
34% identity, 86% coverage: 30:244/249 of query aligns to 9:224/234 of 3k4uE
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
33% identity, 86% coverage: 30:244/249 of query aligns to 22:232/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
33% identity, 86% coverage: 30:244/249 of query aligns to 22:232/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
33% identity, 86% coverage: 30:244/249 of query aligns to 22:232/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
33% identity, 86% coverage: 30:244/249 of query aligns to 18:228/237 of 3vv5A
>8500830 FitnessBrowser__Miya:8500830
MFRMTTLVAALALVLALGGVAFAEKTYINGIDANYPPFAYVDKSGKPAGFDVESMDWIAK
KMGFKVTHQPMDWDGIIPNLLAKKIDMVCSGMSITEERRQKVNFSNPYWNVKQVFIAKKG
STLNTDQILKGKVKLGVQRGTSEAEALQKDKEAKGYGYDLRFYDSAPLAIEDVLNGRIDA
ATMDNLPADDAAAKGKAIQVVGVYGDSEDFGVATRKEDAELLKMINDGYKLLMADPYWEQ
LKQKHLATK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory