SitesBLAST
Comparing 8500969 FitnessBrowser__Miya:8500969 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
45% identity, 100% coverage: 2:607/607 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N101), G99 (= G102), Y248 (= Y252), E481 (= E483), K485 (= K487), E488 (= E490), H504 (= H506), K603 (= K602)
- binding glucose-6-phosphate: T302 (= T303), S347 (= S348), Q348 (= Q349), S349 (= S350), T352 (= T353), V399 (= V399), S401 (= S401), E488 (= E490)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N101), G99 (= G102), D123 (= D126)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
45% identity, 100% coverage: 2:607/607 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N101), G99 (= G102), Y248 (= Y252), E481 (= E483), K485 (= K487), E488 (= E490), H504 (= H506), K603 (= K602)
- binding fructose -6-phosphate: G301 (= G302), T302 (= T303), S303 (= S304), S347 (= S348), Q348 (= Q349), S349 (= S350), T352 (= T353), S401 (= S401), K485 (= K487), E488 (= E490)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
45% identity, 100% coverage: 2:607/607 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N101), G99 (= G102), Y248 (= Y252), E481 (= E483), K485 (= K487), E488 (= E490), H504 (= H506), K603 (= K602)
- binding glucose-6-phosphate: T302 (= T303), S303 (= S304), S347 (= S348), Q348 (= Q349), S349 (= S350), T352 (= T353), S401 (= S401), K485 (= K487), E488 (= E490)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
36% identity, 100% coverage: 2:607/607 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ A8), R32 (= R27), W95 (= W75), N122 (= N101), G123 (= G102), E533 (= E483), K537 (= K487), E540 (= E490), H556 (= H506), K655 (= K602)
- binding glucose-6-phosphate: C353 (= C301), T355 (= T303), S356 (= S304), S400 (= S348), Q401 (= Q349), S402 (= S350), T405 (= T353), S453 (= S401), K537 (= K487), E540 (= E490)
- binding glutamic acid: C1 (= C2), R94 (= R74), W95 (= W75), T97 (= T77), H107 (= H87), G123 (= G102), D147 (= D126)
- binding magnesium ion: S434 (≠ A382), R435 (= R383), T437 (≠ A385)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (= Q241), R322 (= R274), G334 (vs. gap), G424 (= G372), T426 (≠ C374), S434 (≠ A382), T437 (≠ A385), C439 (≠ A387), G440 (≠ V388), V441 (≠ I389), H442 (≠ Y390)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
36% identity, 100% coverage: 2:607/607 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ A8), R32 (= R27), W95 (= W75), N122 (= N101), G123 (= G102), E536 (= E483), K540 (= K487), E543 (= E490), H559 (= H506), K658 (= K602)
- binding glucose-6-phosphate: T358 (= T303), S359 (= S304), S403 (= S348), Q404 (= Q349), S405 (= S350), T408 (= T353), S456 (= S401), K540 (= K487), E543 (= E490)
- binding glutamic acid: C1 (= C2), R94 (= R74), W95 (= W75), T97 (= T77), G123 (= G102), D147 (= D126)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
35% identity, 99% coverage: 2:600/607 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ A8), R32 (= R27), W95 (= W75), N122 (= N101), G123 (= G102), E532 (= E483), K536 (= K487), E539 (= E490), H555 (= H506)
- binding glucose-6-phosphate: G353 (= G302), T354 (= T303), S355 (= S304), S399 (= S348), Q400 (= Q349), S401 (= S350), T404 (= T353), S452 (= S401), E539 (= E490)
- binding magnesium ion: S433 (≠ A382), R434 (= R383), T436 (≠ A385)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (= Q241), R321 (= R274), G333 (vs. gap), G423 (= G372), T425 (≠ C374), S433 (≠ A382), T436 (≠ A385), C438 (≠ A387), G439 (≠ V388), V440 (≠ I389), H441 (≠ Y390)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
34% identity, 100% coverage: 1:607/607 of query aligns to 1:699/699 of Q06210
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
45% identity, 60% coverage: 246:607/607 of query aligns to 1:367/367 of 1mosA
- active site: E240 (= E483), K244 (= K487), E247 (= E490), H263 (= H506), K362 (= K602)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T303), S62 (= S304), S106 (= S348), Q107 (= Q349), S108 (= S350), T111 (= T353), K244 (= K487), E247 (= E490)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
45% identity, 59% coverage: 249:607/607 of query aligns to 3:366/366 of 1morA
- active site: E239 (= E483), K243 (= K487), E246 (= E490), H262 (= H506), K361 (= K602)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T303), S105 (= S348), Q106 (= Q349), S107 (= S350), T110 (= T353), V157 (= V399), A360 (= A601), K361 (= K602)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
45% identity, 59% coverage: 249:607/607 of query aligns to 3:366/366 of 1moqA
- active site: E239 (= E483), K243 (= K487), E246 (= E490), H262 (= H506), K361 (= K602)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T303), S61 (= S304), S105 (= S348), Q106 (= Q349), S107 (= S350), T110 (= T353), V157 (= V399), A360 (= A601), K361 (= K602)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
40% identity, 69% coverage: 189:607/607 of query aligns to 287:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
44% identity, 58% coverage: 249:598/607 of query aligns to 3:357/357 of 7dnrA
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
40% identity, 59% coverage: 249:607/607 of query aligns to 2:365/365 of 2zj4A
- active site: E238 (= E483), K242 (= K487), E245 (= E490), H261 (= H506), K360 (= K602)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T303), S61 (= S304), S105 (= S348), Q106 (= Q349), S107 (= S350), T110 (= T353), V156 (= V399), A157 (= A400), K242 (= K487), E245 (= E490)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
40% identity, 59% coverage: 249:607/607 of query aligns to 2:365/365 of 2zj3A
- active site: E238 (= E483), K242 (= K487), E245 (= E490), H261 (= H506), K360 (= K602)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T303), S61 (= S304), S105 (= S348), Q106 (= Q349), S107 (= S350), T110 (= T353), V156 (= V399), A359 (= A601), K360 (= K602)
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
38% identity, 57% coverage: 249:595/607 of query aligns to 1:352/352 of 2v4mA
- active site: E237 (= E483), K241 (= K487), E244 (= E490), H260 (= H506)
- binding fructose -6-phosphate: T59 (= T303), S60 (= S304), S104 (= S348), Q105 (= Q349), S106 (= S350), T109 (= T353), A156 (= A400), S157 (= S401), K241 (= K487), E244 (= E490)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
41% identity, 57% coverage: 252:595/607 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E483), K240 (= K487), E243 (= E490), H259 (= H506)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C301), T57 (= T303), S58 (= S304), S102 (= S348), Q103 (= Q349), S104 (= S350), T107 (= T353), E243 (= E490)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R274), G36 (≠ E286), G126 (= G372), V128 (≠ C374), S136 (≠ A382), T139 (≠ A385), C141 (≠ A387), G142 (≠ V388), V143 (≠ I389), H144 (≠ Y390)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
39% identity, 57% coverage: 250:595/607 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E483), K241 (= K487), E244 (= E490)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C301), T58 (= T303), S103 (= S348), Q104 (= Q349), S105 (= S350), T108 (= T353), A155 (= A400), E244 (= E490)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (= R274), G37 (≠ E286), G127 (= G372), V129 (≠ C374), S137 (≠ A382), T140 (≠ A385), C142 (≠ A387), G143 (≠ V388), V144 (≠ I389), H145 (≠ Y390)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
39% identity, 57% coverage: 252:595/607 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E483), K240 (= K487), E243 (= E490)
- binding fructose -6-phosphate: C55 (= C301), T57 (= T303), S102 (= S348), Q103 (= Q349), S104 (= S350), T107 (= T353), A154 (= A400), S155 (= S401), K240 (= K487)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R274), G36 (≠ E286), G126 (= G372), V128 (≠ C374), S136 (≠ A382), T139 (≠ A385), C141 (≠ A387), G142 (≠ V388), V143 (≠ I389), H144 (≠ Y390)
2puwB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
40% identity, 57% coverage: 252:595/607 of query aligns to 2:331/331 of 2puwB
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
46% identity, 37% coverage: 2:225/607 of query aligns to 1:222/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N101), G99 (= G102)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N101), G99 (= G102), D123 (= D126)
Query Sequence
>8500969 FitnessBrowser__Miya:8500969
MCGIIGYAGHRPAVPLIIEGLRRLEYRGYDSAGVAFVQNRELITVRAEGKLSALDEKLAS
CPNTVATTGMGHTRWATHGIPVERNAHPHKSNDGGLAIVHNGIIENYAELKADLAAKGYV
FHSETDTEVLANLISEGRKHNATMLDAFAWALRQAHGAYAVALTTPEEPEVLYAARLSAP
LILGVGTGENFVASDIPAFLPYTRDVVFLEDGELVRIDANSWKVMRIADLSPVEKAVNHI
QWDMQAAQKGGYKHFMLKEIFEQPKVITDCLAGRVDWNRMEVTLPELAALPVPKRLHIVA
CGTSYHAGMWGKHLLESWARVPVNVEIASEFRYRDIILDPADMVLVISQSGETADTLAAL
RIAREHGVKVAGLCNVVGSSIAREADAVIYTQAGPEISVASTKAMCSQMVLLTLMALHWG
RNTGALSETVRANVLQTLRKLPGQLETVLPAMRDEAQVLARTYSKAKSFFYLGRGHCFPL
ALEGALKLKEISYIHAEGYASGEMKHGPIALIDPDFPTFALALNDELFPKVKSNIEEVQA
RRGKIIALTNPGVELKVDHPWSIPDAWGPMAAFLVLPALQLFSYEAADYLGKDVDQPRNL
AKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory