SitesBLAST
Comparing 8500984 FitnessBrowser__Miya:8500984 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
4r1mA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution
42% identity, 96% coverage: 13:427/431 of query aligns to 17:433/435 of 4r1mA
- binding adenosine monophosphate: A215 (= A210), E216 (= E211), P217 (≠ T212), N236 (≠ D232), S237 (≠ I233), F238 (≠ A234), G239 (= G235), M240 (= M236), T241 (= T237), D305 (= D301), R329 (= R325), I335 (= I331), N340 (= N336)
- binding zinc ion: C252 (= C248), H259 (= H255), C314 (= C310), C316 (= C312)
4r1lA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution
41% identity, 96% coverage: 13:427/431 of query aligns to 17:431/433 of 4r1lA
- binding adenosine-5'-diphosphate: A215 (= A210), E216 (= E211), P217 (≠ T212), S237 (≠ I233), F238 (≠ A234), G239 (= G235), M240 (= M236), T241 (= T237), D305 (= D301), R329 (= R325), N340 (= N336)
- binding adenosine monophosphate: A215 (= A210), E216 (= E211), P217 (≠ T212), S237 (≠ I233), F238 (≠ A234), G239 (= G235), M240 (= M236), T241 (= T237), D305 (= D301), R329 (= R325), N340 (= N336)
- binding coenzyme a: S136 (≠ A132), A164 (≠ P160), G165 (= G161), N166 (= N162), S167 (≠ L163), I185 (≠ T181), Y188 (≠ M184), K337 (≠ R333), T408 (≠ R402)
- binding zinc ion: C252 (= C248), H259 (= H255), C314 (= C310), C316 (= C312)
2y27B Crystal structure of paak1 in complex with atp from burkholderia cenocepacia (see paper)
44% identity, 96% coverage: 13:427/431 of query aligns to 13:427/427 of 2y27B
- binding adenosine-5'-triphosphate: K65 (≠ V65), S90 (= S90), S91 (= S91), G92 (= G92), T93 (= T93), T94 (= T94), F138 (≠ W138), A211 (= A210), E212 (= E211), P213 (≠ T212), D232 (= D232), I233 (= I233), Y234 (≠ A234), G235 (= G235), L236 (≠ M236), S237 (≠ T237), D302 (= D301), I320 (= I322), R323 (= R325), K419 (= K419)
- binding magnesium ion: V200 (= V201), S202 (vs. gap), L204 (= L203), M226 (≠ L225), G227 (= G226), Q347 (≠ F349), L350 (= L352)
2y4nA Paak1 in complex with phenylacetyl adenylate (see paper)
44% identity, 96% coverage: 13:427/431 of query aligns to 13:425/426 of 2y4nA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: Y131 (≠ V133), F136 (≠ W138), G138 (≠ A140), G208 (= G209), A209 (= A210), E210 (= E211), P211 (≠ T212), I231 (= I233), Y232 (≠ A234), G233 (= G235), L234 (≠ M236), S235 (≠ T237), P240 (= P242), D300 (= D301), R321 (= R325), K417 (= K419)
- binding magnesium ion: V198 (= V201), S200 (vs. gap), Q345 (≠ F349), L348 (= L352)
2y4oA Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
41% identity, 96% coverage: 13:427/431 of query aligns to 15:432/433 of 2y4oA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ V133), F140 (≠ W138), A213 (= A210), E214 (= E211), P215 (≠ T212), I235 (= I233), G237 (= G235), L238 (≠ M236), S239 (≠ T237), P244 (= P242), D304 (= D301), R325 (= R325), I331 (= I331), N336 (= N336)
2y4oB Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
41% identity, 96% coverage: 13:427/431 of query aligns to 15:432/432 of 2y4oB
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ V133), F140 (≠ W138), G212 (= G209), A213 (= A210), E214 (= E211), P215 (≠ T212), I235 (= I233), G237 (= G235), L238 (≠ M236), S239 (≠ T237), P244 (= P242), D304 (= D301), R325 (= R325), I331 (= I331), N336 (= N336)
- binding magnesium ion: S204 (≠ V201), V228 (≠ L225)
6he0A Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state (see paper)
31% identity, 94% coverage: 23:427/431 of query aligns to 45:464/477 of 6he0A
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] 2-methyl-2-oxidanyl-propanoate: S241 (≠ G209), G242 (≠ A210), E243 (= E211), P244 (≠ T212), G267 (≠ A234), S268 (≠ G235), M269 (= M236), A270 (≠ T237), D335 (= D301), I357 (= I322), N371 (= N336)
- binding adenosine monophosphate: G242 (≠ A210), E243 (= E211), P244 (≠ T212), C266 (≠ I233), G267 (≠ A234), S268 (≠ G235), A270 (≠ T237), E271 (= E238), D335 (= D301), N371 (= N336)
- binding coenzyme a: Y166 (≠ W138), A188 (vs. gap), G189 (vs. gap), P191 (= P160), S194 (≠ L163), Y210 (≠ G179), G211 (≠ S180), T212 (= T181), Y215 (≠ M184), H218 (≠ L187), R368 (= R333), G369 (= G334), M401 (≠ R366), V439 (≠ A401), R440 (= R402)
6hdyA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with s3-hb-amp (see paper)
30% identity, 94% coverage: 23:427/431 of query aligns to 45:461/474 of 6hdyA
- binding (3s)-3-hydroxybutanoic acid: Y162 (≠ W138), S237 (≠ G209), G263 (≠ A234), S264 (≠ G235), M265 (= M236), A266 (≠ T237), F271 (≠ Y240)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (3~{S})-3-oxidanylbutanoate: Y162 (≠ W138), G164 (≠ A140), S237 (≠ G209), G238 (≠ A210), E239 (= E211), P240 (≠ T212), C262 (≠ I233), G263 (≠ A234), S264 (≠ G235), A266 (≠ T237), F271 (≠ Y240), D331 (= D301), I353 (= I322), R356 (= R325), K453 (= K419)
6hdxA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with r3-hib-amp (see paper)
30% identity, 94% coverage: 23:427/431 of query aligns to 45:461/474 of 6hdxA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (2~{R})-2-methyl-3-oxidanyl-propanoate: Y162 (≠ W138), G164 (≠ A140), S237 (≠ G209), G238 (≠ A210), E239 (= E211), P240 (≠ T212), C262 (≠ I233), G263 (≠ A234), S264 (≠ G235), A266 (≠ T237), F271 (≠ Y240), D331 (= D301), I353 (= I322), R356 (= R325), K453 (= K419)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: Y162 (≠ W138), G164 (≠ A140), S237 (≠ G209), G263 (≠ A234), S264 (≠ G235), A266 (≠ T237), F271 (≠ Y240)
6siyA Paak family amp-ligase with amp and substrate (see paper)
27% identity, 94% coverage: 7:413/431 of query aligns to 14:401/433 of 6siyA
- binding 3-hydroxyanthranilic acid: T125 (≠ V133), P126 (≠ G134), T132 (≠ A140), L135 (≠ G143), R153 (≠ G161), N177 (≠ T181), A209 (= A210), E232 (≠ I233), G234 (= G235), S235 (≠ M236)
- binding adenosine monophosphate: S85 (= S91), A209 (= A210), E210 (= E211), P211 (≠ T212), E232 (≠ I233), Y233 (≠ A234), G234 (= G235), S235 (≠ M236), T236 (= T237), D296 (= D301), V316 (≠ I322)
- binding magnesium ion: R75 (≠ E81), E76 (≠ S82), L78 (≠ V84), P117 (≠ R125), G144 (= G152), A145 (= A153), T146 (≠ L154)
6siwA Paak family amp-ligase with amp (see paper)
27% identity, 94% coverage: 7:413/431 of query aligns to 13:400/432 of 6siwA
- binding adenosine monophosphate: S84 (= S91), A208 (= A210), E209 (= E211), P210 (≠ T212), E231 (≠ I233), Y232 (≠ A234), G233 (= G235), S234 (≠ M236), T235 (= T237), D295 (= D301), V315 (≠ I322)
- binding magnesium ion: E75 (≠ S82), L77 (≠ V84), S83 (= S90), P116 (≠ R125), G143 (= G152), T145 (≠ L154), E236 (= E238)
- binding zinc ion: C244 (≠ E247), H250 (= H255), C304 (= C310), C306 (= C312)
6sixB Paak family amp-ligase with anp (see paper)
27% identity, 94% coverage: 7:413/431 of query aligns to 18:405/437 of 6sixB
- binding phosphoaminophosphonic acid-adenylate ester: S88 (= S90), S89 (= S91), A213 (= A210), E214 (= E211), P215 (≠ T212), E236 (≠ I233), Y237 (≠ A234), G238 (= G235), S239 (≠ M236), T240 (= T237), E241 (= E238), D300 (= D301), V320 (≠ I322), R323 (= R325)
- binding magnesium ion: R79 (≠ E81), E80 (≠ S82), P121 (≠ R125), T150 (≠ L154)
- binding zinc ion: C249 (≠ E247), H255 (= H255), C309 (= C310), C311 (= C312)
Query Sequence
>8500984 FitnessBrowser__Miya:8500984
MSQYRFLPHLDPETLHRVQTEGLRWTVRHAYANSPAYKAKFDAAGVHPDDIRTLDDIVRL
PTASVEDLREGYPLPLLSVPESDVVRIHASSGTTGKRKILAYTQNDVDTFALQMARCYEL
AGLTREDRVQIAVGYGLWTAGAGFQLGSEKFGALTVPVGPGNLEMQLQLLVDMGVTCLGS
TASMALLMAEEVERNGLLDKVKLRKVIFGAETHSPRMRATFEQKLGLTGSYDIAGMTEMY
GPGTGLECDAREGLHYWADLFIIEILDPATLQPVAPGEVGEMVVTSLRKEASPLVRYRTR
DLTRMLPGQCSCGRCIPRHDHILGRSDDMIIFRGVNIYPGQIADVLHEFPVLGSEYHIQL
TRTDGRDAMLLQVERQEGTTADADAGLAREVGDRLHKKLMARVAVQMVDPGVLPRSFGKS
KRVTDLRMADG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory