SitesBLAST
Comparing 8501004 FitnessBrowser__Miya:8501004 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
63% identity, 96% coverage: 4:383/394 of query aligns to 1:381/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H83), K82 (= K84), Q109 (= Q111), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), E345 (= E347), S371 (= S373), G372 (= G374)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
59% identity, 97% coverage: 5:386/394 of query aligns to 2:384/388 of 5dw0A
- active site: K82 (= K84), E104 (= E106), S371 (= S373)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H83), K82 (= K84), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), G298 (= G300), D300 (= D302), E345 (= E347), S371 (= S373)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
59% identity, 97% coverage: 5:386/394 of query aligns to 2:384/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
59% identity, 97% coverage: 5:386/394 of query aligns to 2:384/386 of 1v8zA
- active site: K82 (= K84), E104 (= E106), S371 (= S373)
- binding pyridoxal-5'-phosphate: H81 (= H83), K82 (= K84), Q109 (= Q111), S185 (≠ T187), G227 (= G229), G228 (= G230), G229 (= G231), S230 (= S232), N231 (= N233), E345 (= E347), S371 (= S373), G372 (= G374)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
59% identity, 97% coverage: 5:386/394 of query aligns to 2:383/383 of 5dw3A
- active site: K82 (= K84), E104 (= E106), S370 (= S373)
- binding tryptophan: K82 (= K84), E104 (= E106), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G228 (= G230), Y300 (= Y303)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
59% identity, 96% coverage: 5:383/394 of query aligns to 2:381/385 of 6am8B
- active site: K82 (= K84), E104 (= E106), S371 (= S373)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H83), K82 (= K84), E104 (= E106), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), L161 (= L163), S185 (≠ T187), V187 (≠ A189), G227 (= G229), G228 (= G230), G229 (= G231), S230 (= S232), N231 (= N233), G298 (= G300), Y301 (= Y303), E345 (= E347), S371 (= S373), G372 (= G374)
- binding tryptophan: P12 (= P15), L169 (= L171), S274 (≠ L276), H275 (= H277)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
59% identity, 97% coverage: 5:386/394 of query aligns to 2:382/383 of 5t6mA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
59% identity, 97% coverage: 5:386/394 of query aligns to 2:382/394 of 5ixjD
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
59% identity, 96% coverage: 5:383/394 of query aligns to 2:381/384 of 7rnpA
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
59% identity, 96% coverage: 5:383/394 of query aligns to 2:381/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H83), K82 (= K84), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), G298 (= G300), E345 (= E347), S371 (= S373)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
59% identity, 96% coverage: 5:383/394 of query aligns to 2:381/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H83), K82 (= K84), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), G298 (= G300), E345 (= E347), S371 (= S373)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
59% identity, 96% coverage: 5:383/394 of query aligns to 2:379/383 of 5vm5D
- active site: K82 (= K84), E104 (= E106), S369 (= S373)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H83), K82 (= K84), T105 (= T107), G106 (= G108), A107 (= A109), Q109 (= Q111), H110 (= H112), S185 (≠ T187), G227 (= G229), G229 (= G231), S230 (= S232), N231 (= N233), G296 (= G300), E343 (= E347), S369 (= S373)
6xt0B Salmonella typhimurium tryptophan synthase complexed with dioxindolyl- l-alanine and d-glycerol-3-phosphate (see paper)
58% identity, 99% coverage: 5:393/394 of query aligns to 7:396/396 of 6xt0B
- active site: K86 (= K84), E108 (= E106), S376 (= S373)
- binding sodium ion: G231 (= G229), P269 (= P267), F305 (≠ Y303), S307 (≠ G305)
- binding 4-[(E)-({1-carboxy-2-[(3R)-3-hydroxy-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H83), K86 (= K84), E108 (= E106), T109 (= T107), G110 (= G108), Q113 (= Q111), H114 (= H112), L165 (= L163), G188 (= G186), T189 (= T187), G231 (= G229), G232 (= G230), G233 (= G231), S234 (= S232), N235 (= N233), G302 (= G300), F305 (≠ Y303), E349 (= E347), S376 (= S373)
- binding 4-[(E)-({1-carboxy-2-[(3R)-3-hydroxy-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H83), K86 (= K84), E108 (= E106), T109 (= T107), G110 (= G108), Q113 (= Q111), H114 (= H112), L165 (= L163), T189 (= T187), G231 (= G229), G232 (= G230), G233 (= G231), S234 (= S232), N235 (= N233), G302 (= G300), F305 (≠ Y303), E349 (= E347), S376 (= S373), G377 (= G374)
6xrhB Salmonella typhimurium tryptophan synthase complexed with oxindolyl-l- alanine and d-glycerol-3-phosphate (see paper)
58% identity, 99% coverage: 5:393/394 of query aligns to 7:396/396 of 6xrhB
- active site: K86 (= K84), E108 (= E106), S376 (= S373)
- binding sodium ion: G231 (= G229), P269 (= P267), F305 (≠ Y303), S307 (≠ G305)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-3-[(3S)-2-oxo-2,3-dihydro-1H-indol-3-yl]-L-alanine: H85 (= H83), K86 (= K84), T109 (= T107), G110 (= G108), A111 (= A109), Q113 (= Q111), H114 (= H112), L165 (= L163), G188 (= G186), T189 (= T187), V230 (= V228), G231 (= G229), G232 (= G230), G233 (= G231), S234 (= S232), N235 (= N233), G302 (= G300), F305 (≠ Y303), E349 (= E347), S376 (= S373)
- binding 4-[(E)-({1-carboxy-2-[(3S)-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H83), K86 (= K84), E108 (= E106), T109 (= T107), G110 (= G108), Q113 (= Q111), H114 (= H112), L165 (= L163), T189 (= T187), G231 (= G229), G232 (= G230), G233 (= G231), S234 (= S232), N235 (= N233), G302 (= G300), F305 (≠ Y303), E349 (= E347), S376 (= S373)
6xoyB Salmonella typhimurium tryptophan synthase complexed with d-tryptophan and d-glycerol-3-phosphate (see paper)
58% identity, 99% coverage: 5:393/394 of query aligns to 7:396/396 of 6xoyB
- active site: K86 (= K84), E108 (= E106), S376 (= S373)
- binding sodium ion: G231 (= G229), P269 (= P267), F305 (≠ Y303), S307 (≠ G305)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-D-tryptophan: H85 (= H83), K86 (= K84), E108 (= E106), T109 (= T107), G110 (= G108), A111 (= A109), Q113 (= Q111), H114 (= H112), L165 (= L163), T189 (= T187), G231 (= G229), G232 (= G230), G233 (= G231), S234 (= S232), N235 (= N233), G302 (= G300), F305 (≠ Y303), E349 (= E347), S376 (= S373)
6xinB The crystal structure of tryptophan synthase from salmonella enterica serovar typhimurium in complex with (2s)-3-amino-3-imino-2- phenyldiazenylpropanamide at the enzyme alpha-site.
58% identity, 99% coverage: 5:393/394 of query aligns to 7:396/396 of 6xinB
- active site: K86 (= K84), E108 (= E106), S376 (= S373)
- binding pyridoxal-5'-phosphate: H85 (= H83), K86 (= K84), T189 (= T187), G231 (= G229), G233 (= G231), S234 (= S232), N235 (= N233), E349 (= E347), S376 (= S373), G377 (= G374)
- binding (2R,3Z)-3-amino-3-imino-2-[(E)-phenyldiazenyl]propanamide: V16 (= V14), P17 (= P15), L20 (= L18), L173 (= L171), Y185 (= Y183), L187 (≠ F185), P193 (= P191), F279 (≠ H277)
4kkxB Crystal structure of tryptophan synthase from salmonella typhimurium with 2-aminophenol quinonoid in the beta site and the f6 inhibitor in the alpha site (see paper)
58% identity, 98% coverage: 5:392/394 of query aligns to 7:395/395 of 4kkxB
- active site: K86 (= K84), E108 (= E106), S376 (= S373)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-3-[(2-hydroxyphenyl)amino]-D-alanine: H85 (= H83), K86 (= K84), E108 (= E106), T109 (= T107), G110 (= G108), A111 (= A109), Q113 (= Q111), H114 (= H112), L165 (= L163), T189 (= T187), G231 (= G229), G232 (= G230), G233 (= G231), S234 (= S232), N235 (= N233), G302 (= G300), F305 (≠ Y303), E349 (= E347), S376 (= S373), G377 (= G374)
4hpxB Crystal structure of tryptophan synthase at 1.65 a resolution in complex with alpha aminoacrylate e(a-a) and benzimidazole in the beta site and the f9 inhibitor in the alpha site (see paper)
58% identity, 98% coverage: 5:392/394 of query aligns to 7:395/395 of 4hpxB
- active site: K86 (= K84), E108 (= E106), S376 (= S373)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H85 (= H83), K86 (= K84), T109 (= T107), G110 (= G108), A111 (= A109), G112 (= G110), Q113 (= Q111), H114 (= H112), T189 (= T187), G231 (= G229), G232 (= G230), G233 (= G231), S234 (= S232), N235 (= N233), G302 (= G300), E349 (= E347), S376 (= S373), G377 (= G374)
- binding benzimidazole: K86 (= K84), E108 (= E106), A135 (= A133), K136 (≠ T134), L165 (= L163), G188 (= G186), T189 (= T187), G231 (= G229), G232 (= G230), F305 (≠ Y303)
Sites not aligning to the query:
4hpjB Crystal structure of tryptophan synthase at 1.45 a resolution in complex with 2-aminophenol quinonoid in the beta site and the f9 inhibitor in the alpha site (see paper)
58% identity, 98% coverage: 5:392/394 of query aligns to 7:395/395 of 4hpjB
- active site: K86 (= K84), E108 (= E106), S376 (= S373)
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]-3-[(2-hydroxyphenyl)amino]propanoic acid: H85 (= H83), K86 (= K84), E108 (= E106), T109 (= T107), G110 (= G108), A111 (= A109), Q113 (= Q111), H114 (= H112), L165 (= L163), T189 (= T187), G231 (= G229), G232 (= G230), G233 (= G231), S234 (= S232), N235 (= N233), G302 (= G300), E349 (= E347), S376 (= S373), G377 (= G374)
4hn4B Tryptophan synthase in complex with alpha aminoacrylate e(a-a) form and the f9 inhibitor in the alpha site (see paper)
58% identity, 98% coverage: 5:392/394 of query aligns to 7:395/395 of 4hn4B
- active site: K86 (= K84), E108 (= E106), S376 (= S373)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H85 (= H83), K86 (= K84), T109 (= T107), G110 (= G108), A111 (= A109), Q113 (= Q111), H114 (= H112), T189 (= T187), G231 (= G229), G233 (= G231), S234 (= S232), N235 (= N233), G302 (= G300), E349 (= E347), S376 (= S373), G377 (= G374)
Query Sequence
>8501004 FitnessBrowser__Miya:8501004
MKKGYFGEFGGQFVPELLMPPLRELEAAMRDILPSDKFRAELDDLLRNFAGRETPLTACP
TLSAELGVHLWLKREDLLHTGAHKVNNTLGQALLAKYMGKTALVAETGAGQHGVATAAAA
ARLGMECVIYMGATDVVRQAPNVMRMKLLGAKVVPVQSGTKTLKDAINEALRYWIAQQDS
THYCFGTAAGPHPFPTLVRDLQSVIGRESRAQMLERVGRLPDMVVACVGGGSNAIGMFHP
FIDDASVRIVGVEAAGTGEPGCYNSAPINLGRPGVLHGQMTMLLQDADGQIEPSHSVSAG
LDYPGVGPEHAHLGAIGRAAYGMATDSQALEAFQALTRREGIIPALESSHALAWVLNNRD
KLPAGGHVVVNLSGRGDKDMEIVREVLFREGELA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory