Comparing 8501008 FitnessBrowser__Miya:8501008 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
47% identity, 96% coverage: 1:185/192 of query aligns to 1:184/187 of P00903
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
43% identity, 96% coverage: 2:185/192 of query aligns to 75:263/276 of Q42565
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
44% identity, 95% coverage: 3:185/192 of query aligns to 7:187/673 of 8hx8A
Sites not aligning to the query:
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
43% identity, 94% coverage: 2:182/192 of query aligns to 4:183/193 of P00900
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
43% identity, 94% coverage: 2:182/192 of query aligns to 3:182/192 of 1i7qB
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
36% identity, 95% coverage: 3:185/192 of query aligns to 6:144/632 of 8hx9A
Sites not aligning to the query:
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
26% identity, 96% coverage: 1:185/192 of query aligns to 1:174/183 of 7yc6A
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
38% identity, 58% coverage: 74:185/192 of query aligns to 72:180/475 of 2ywcA
Sites not aligning to the query:
3r75B Crystal structure of 2-amino-2-desoxyisochorismate synthase (adic) synthase phze from burkholderia lata 383 in complex with benzoate, pyruvate, glutamine and contaminating zn2+ (see paper)
29% identity, 99% coverage: 3:192/192 of query aligns to 434:620/622 of 3r75B
Sites not aligning to the query:
P20054 Multifunctional protein pyr1-3; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Dictyostelium discoideum (Social amoeba)
29% identity, 75% coverage: 48:191/192 of query aligns to 240:384/2225 of P20054
Sites not aligning to the query:
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
28% identity, 75% coverage: 48:191/192 of query aligns to 50:193/490 of 5tw7F
Sites not aligning to the query:
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
28% identity, 71% coverage: 46:182/192 of query aligns to 215:349/2225 of P27708
Sites not aligning to the query:
Q09794 Multifunctional protein ura1; Pyrimidine-specific carbamoyl phosphate synthase-aspartate carbamoyl transferase; CPSase-ATCase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 69% coverage: 50:182/192 of query aligns to 306:435/2244 of Q09794
Sites not aligning to the query:
P05990 Multifunctional protein r; Protein rudimentary; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Drosophila melanogaster (Fruit fly) (see 2 papers)
24% identity, 76% coverage: 38:182/192 of query aligns to 225:366/2224 of P05990
Sites not aligning to the query:
Q9LVW7 Carbamoyl phosphate synthase small chain, chloroplastic; Carbamoyl phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 83% coverage: 14:172/192 of query aligns to 254:405/430 of Q9LVW7
Sites not aligning to the query:
P0A6F1 Carbamoyl phosphate synthase small chain; Carbamoyl phosphate synthetase glutamine chain; EC 6.3.5.5 from Escherichia coli (strain K12) (see paper)
29% identity, 71% coverage: 36:172/192 of query aligns to 219:356/382 of P0A6F1
Sites not aligning to the query:
1ce8B Carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp (see paper)
29% identity, 71% coverage: 36:172/192 of query aligns to 218:355/379 of 1ce8B
Sites not aligning to the query:
Q18990 Multifunctional protein pyr-1; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Caenorhabditis elegans (see 3 papers)
26% identity, 69% coverage: 50:182/192 of query aligns to 223:352/2198 of Q18990
Sites not aligning to the query:
1c3oB Crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine (see paper)
30% identity, 71% coverage: 36:172/192 of query aligns to 218:355/379 of 1c3oB
Sites not aligning to the query:
>8501008 FitnessBrowser__Miya:8501008
MFLLIDNYDSFTFNLVQAFYGLGLHPVVVRNDDPAVPAMAEDPALEMVCISPGPSHPRNA
GFCLDFLSRLPHRVPVLGVCLGHQVLGLFAGATVDVGPRIMHGKTSDITHDGQGLFHGVP
SPMQVGRYHSLIVHAEERPDLLAVTARAPEGEVMALRYTDRPWVGVQFHPESVLTPDGVR
MLANFPAHVAGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory