Comparing 8501010 FitnessBrowser__Miya:8501010 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
27% identity, 96% coverage: 5:257/263 of query aligns to 11:268/280 of 2pv7B
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
27% identity, 67% coverage: 4:180/263 of query aligns to 1:193/279 of 2f1kA
5t9fB Prephenate dehydrogenase n222d mutant from soybean (see paper)
25% identity, 83% coverage: 2:218/263 of query aligns to 1:227/253 of 5t9fB
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
23% identity, 67% coverage: 6:181/263 of query aligns to 8:204/286 of 3ggpA
Sites not aligning to the query:
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
23% identity, 67% coverage: 6:181/263 of query aligns to 8:204/285 of 3ggoA
Sites not aligning to the query:
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
23% identity, 67% coverage: 6:181/263 of query aligns to 16:212/293 of 3gggD
Sites not aligning to the query:
>8501010 FitnessBrowser__Miya:8501010
MNAVKIALVGAGGRMGRLFADRLSAAGYAVGGVDRPLTQDVLRHAVDGAAAVLLCVPVEV
MDEVLRQVAPLLNGMQVLADITSVKVRPMQVMERHYAGPVVGTHPLFGPVPPAGDPAENL
RVAVTPGDTAHETDVALIERVFADMGCVPFRTTADEHDEAAACIQGLNFITSVAYLATLA
HRDELTPFITPSFRRRLDAARKMLTEDASLFEGMFEANPHSQTAVRSYLSFLNFAAAGDV
DVLVDRAQWWWRSHTERGGVRPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory