Comparing 8501057 FitnessBrowser__Miya:8501057 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
52% identity, 99% coverage: 1:161/163 of query aligns to 1:159/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
52% identity, 99% coverage: 1:161/163 of query aligns to 1:159/167 of 2pkpA
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
42% identity, 55% coverage: 13:101/163 of query aligns to 554:653/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 59% coverage: 13:108/163 of query aligns to 18:118/198 of P9WK95
Sites not aligning to the query:
P39533 Homocitrate dehydratase, mitochondrial; Aconitase 2; EC 4.2.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 67% coverage: 12:120/163 of query aligns to 614:728/789 of P39533
Sites not aligning to the query:
Q9SIB9 Aconitate hydratase 3, mitochondrial; Aconitase 3; mACO1; Citrate hydro-lyase 3; EC 4.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 67% coverage: 54:163/163 of query aligns to 864:988/990 of Q9SIB9
Sites not aligning to the query:
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
36% identity, 52% coverage: 54:138/163 of query aligns to 658:740/780 of P20004
Sites not aligning to the query:
P19414 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
39% identity, 41% coverage: 54:120/163 of query aligns to 655:723/778 of P19414
Sites not aligning to the query:
5acnA Structure of activated aconitase. Formation of the (4fe-4s) cluster in the crystal (see paper)
33% identity, 53% coverage: 54:139/163 of query aligns to 631:718/754 of 5acnA
Sites not aligning to the query:
P09339 Aconitate hydratase A; ACN; Aconitase; Aconitate/2-methylaconitate hydratase; Iron-responsive protein-like; IRP-like; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.- from Bacillus subtilis (strain 168) (see 2 papers)
38% identity, 46% coverage: 47:121/163 of query aligns to 774:852/909 of P09339
Sites not aligning to the query:
8acnA Crystal structures of aconitase with isocitrate and nitroisocitrate bound (see paper)
34% identity, 52% coverage: 54:138/163 of query aligns to 630:712/753 of 8acnA
Sites not aligning to the query:
1fghA Complex with 4-hydroxy-trans-aconitate (see paper)
34% identity, 52% coverage: 54:138/163 of query aligns to 630:712/753 of 1fghA
Sites not aligning to the query:
1amjA Steric and conformational features of the aconitase mechanism (see paper)
34% identity, 52% coverage: 54:138/163 of query aligns to 630:712/753 of 1amjA
Sites not aligning to the query:
1amiA Steric and conformational features of the aconitase mechanism (see paper)
34% identity, 52% coverage: 54:138/163 of query aligns to 630:712/753 of 1amiA
Sites not aligning to the query:
1acoA Crystal structure of aconitase with transaconitate bound (see paper)
34% identity, 52% coverage: 54:138/163 of query aligns to 630:712/753 of 1acoA
Sites not aligning to the query:
P16276 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Sus scrofa (Pig) (see 3 papers)
33% identity, 53% coverage: 54:139/163 of query aligns to 658:745/781 of P16276
Sites not aligning to the query:
1nisA Crystal structure of aconitase with trans-aconitate and nitrocitrate bound (see paper)
34% identity, 52% coverage: 54:138/163 of query aligns to 630:712/753 of 1nisA
Sites not aligning to the query:
1b0kA S642a:fluorocitrate complex of aconitase (see paper)
32% identity, 53% coverage: 54:139/163 of query aligns to 630:717/753 of 1b0kA
Sites not aligning to the query:
>8501057 FitnessBrowser__Miya:8501057
MSYTGTAHKVGEHIDTDAIIPARFLVTTDTQKLGENCMAGLEEGWVKRVKPGDVMVAGRN
FGCGSSREHAPIAILGAGMPVVIAHSFARIFYRNAFNMGLLLLEVGDEVDKIADGDTVEV
DAAKGLITNRTTGATITCPPLPASMRELLDKGGLVPYVREKLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory