Comparing 8501086 FitnessBrowser__Miya:8501086 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6qp3A Crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) (see paper)
41% identity, 98% coverage: 6:403/405 of query aligns to 1:386/387 of 6qp3A
4dq6A Crystal structure of plp-bound putative aminotransferase from clostridium difficile 630
33% identity, 99% coverage: 5:404/405 of query aligns to 2:388/388 of 4dq6A
3l8aB Crystal structure of metc from streptococcus mutans
35% identity, 99% coverage: 6:405/405 of query aligns to 2:385/385 of 3l8aB
1c7oA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex (see paper)
33% identity, 98% coverage: 6:403/405 of query aligns to 3:390/394 of 1c7oA
1c7nA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor (see paper)
33% identity, 98% coverage: 6:403/405 of query aligns to 3:390/394 of 1c7nA
3b1eA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form (see paper)
33% identity, 99% coverage: 5:405/405 of query aligns to 2:387/387 of 3b1eA
3b1dA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: external aldimine form (see paper)
33% identity, 99% coverage: 5:405/405 of query aligns to 2:387/387 of 3b1dA
3b1cA Crystal structure of betac-s lyase from streptococcus anginosus: internal aldimine form (see paper)
33% identity, 99% coverage: 5:405/405 of query aligns to 2:387/387 of 3b1cA
5z0qC Crystal structure of ovob (see paper)
37% identity, 98% coverage: 6:403/405 of query aligns to 1:375/379 of 5z0qC
8bobA Structural basis for negative regulation of the maltose system (see paper)
33% identity, 97% coverage: 6:396/405 of query aligns to 2:379/390 of 8bobA
P23256 Protein MalY; EC 4.4.1.13 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 97% coverage: 6:396/405 of query aligns to 2:379/390 of P23256
7qugA Crystal structure of carbon-sulfur lyase fnapatb1 from fusobacterium nucleatum subspecies animalis in complex with allyl-cysteine (see paper)
30% identity, 99% coverage: 6:405/405 of query aligns to 2:396/397 of 7qugA
6qp2A Crystal structure of the plp-bound c-s lyase from staphylococcus hominis (see paper)
29% identity, 98% coverage: 6:403/405 of query aligns to 1:378/383 of 6qp2A
6qp1B Crystal structure of the plp-bound c-s lyase in the external aldimine form from staphylococcus hominis complexed with an inhibitor, l- cycloserine. (see paper)
28% identity, 99% coverage: 5:403/405 of query aligns to 7:397/398 of 6qp1B
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
26% identity, 90% coverage: 40:403/405 of query aligns to 32:396/399 of 5wmhA
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
26% identity, 90% coverage: 40:403/405 of query aligns to 32:396/402 of 5wmiA
Sites not aligning to the query:
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
24% identity, 91% coverage: 38:405/405 of query aligns to 26:384/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
24% identity, 91% coverage: 38:405/405 of query aligns to 26:384/388 of 1gd9A
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
26% identity, 90% coverage: 40:403/405 of query aligns to 33:397/404 of 5wmlA
Sites not aligning to the query:
5verA Mouse kynurenine aminotransferase iii, re-refinement of the PDB structure 3e2z (see paper)
28% identity, 79% coverage: 48:366/405 of query aligns to 34:358/410 of 5verA
Sites not aligning to the query:
>8501086 FitnessBrowser__Miya:8501086
MSDHSFDFDHAPDRRNTGSLKWDDMGHMFNLSPDEAANAIPLWVADMDFPSPPAVRDAVA
RLAERGVFGYPADGTACREAVSHWLAARHGWTVNPRHLLPLPTVVASLCLSVRLFTRPGD
GVVIQTPIYPPFRAAVQDAGCRVLANPLTLTTDAGGNPFHEIDFDALDTALADGGRGAKV
LLLCSPHNPGGRVWTRAELTRVAELCLKHGTLMVSDEIHHDLLLPGHAHTVLASLAPEVA
ERTITAVSAAKAFNVPGAGLAHVVIEDDTLRRTFRAELTGLGIRHPNMFGLATTEAACRH
GGPWLDALMAYIAGNAALVRDVLTARLPGVRVMQPQGTYLSWVDFRPLGLAEADLLHRVR
FDAGVVPSPGSSFGPEGDGWLRLNLGCPRALLRTALERMADVLGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory