Comparing 8501090 FitnessBrowser__Miya:8501090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 99% coverage: 3:331/333 of query aligns to 2:323/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 99% coverage: 1:331/333 of query aligns to 1:318/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
35% identity, 98% coverage: 4:331/333 of query aligns to 3:307/310 of 4fwiB
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
35% identity, 79% coverage: 2:263/333 of query aligns to 1:252/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
36% identity, 78% coverage: 2:260/333 of query aligns to 1:249/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
35% identity, 78% coverage: 2:260/333 of query aligns to 1:249/250 of 7z16I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 76% coverage: 3:255/333 of query aligns to 1:236/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 72% coverage: 20:258/333 of query aligns to 13:239/240 of 4ymuJ
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
31% identity, 70% coverage: 20:252/333 of query aligns to 38:260/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
31% identity, 70% coverage: 20:252/333 of query aligns to 38:260/382 of 7aheC
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 76% coverage: 4:255/333 of query aligns to 3:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 76% coverage: 4:255/333 of query aligns to 3:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 76% coverage: 4:255/333 of query aligns to 3:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 76% coverage: 4:255/333 of query aligns to 3:238/242 of 2oljA
7ahdC Opua (e190q) occluded (see paper)
30% identity, 70% coverage: 20:252/333 of query aligns to 38:260/260 of 7ahdC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 76% coverage: 4:255/333 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
30% identity, 67% coverage: 4:225/333 of query aligns to 2:213/222 of 7arlD
7mdyC Lolcde nucleotide-bound
30% identity, 67% coverage: 4:225/333 of query aligns to 2:213/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 67% coverage: 4:225/333 of query aligns to 5:216/233 of P75957
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 76% coverage: 4:255/333 of query aligns to 2:242/344 of 6cvlD
>8501090 FitnessBrowser__Miya:8501090
MQPLLDVSNLTVKFALRDTALTAVNDVSFTLAKGERLGLVGESGAGKSVTGFSILNLVSK
PGFIAGGSVLFEGKDLTRADAETLRDIRGNRISMIFQDPMMTLNPVLTVGTQMIETILAH
KKVTRKEAEAIALDKLRKVYIPSPERRLAQYPHEFSGGMRQRIVIAIALLTSPSLIIADE
PTTALDVTIQAEIMDLLLELCQSEDMGLILITHDLGVVSQVTQKIAVMYAGGIVEMGDTA
MVVGEPLHPYTRGLLGALPQCADKADCGLEDVAAPRVRRRLNQIPGSMPSLSDVPRGCPF
NNRCELCETVCTTTRPLLEVKSDGRMAACHMVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory