Comparing 8501107 FitnessBrowser__Miya:8501107 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
36% identity, 49% coverage: 55:162/222 of query aligns to 74:179/183 of 3nz2C
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
36% identity, 49% coverage: 55:162/222 of query aligns to 77:182/185 of 3nz2J
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
36% identity, 49% coverage: 55:162/222 of query aligns to 67:172/176 of 3ectA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
29% identity, 53% coverage: 46:162/222 of query aligns to 68:182/190 of 5u2kA
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
39% identity, 41% coverage: 72:162/222 of query aligns to 96:184/188 of 3igjC
Sites not aligning to the query:
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
32% identity, 53% coverage: 46:163/222 of query aligns to 52:164/210 of 6pubA
Sites not aligning to the query:
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
32% identity, 53% coverage: 46:163/222 of query aligns to 49:161/206 of 6u9cA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
37% identity, 41% coverage: 72:162/222 of query aligns to 94:182/186 of 4isxA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 59% coverage: 34:165/222 of query aligns to 56:186/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
28% identity, 59% coverage: 34:165/222 of query aligns to 55:185/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
28% identity, 59% coverage: 34:165/222 of query aligns to 55:185/201 of 1kruA
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
28% identity, 59% coverage: 34:165/222 of query aligns to 55:185/200 of 1krrA
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
28% identity, 41% coverage: 72:162/222 of query aligns to 60:165/204 of 1mrlA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
28% identity, 41% coverage: 72:162/222 of query aligns to 60:165/205 of 1kk4A
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
28% identity, 41% coverage: 72:162/222 of query aligns to 60:165/206 of 1khrA
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
28% identity, 41% coverage: 72:162/222 of query aligns to 60:165/203 of 3dhoA
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
28% identity, 39% coverage: 72:158/222 of query aligns to 60:161/209 of P50870
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
32% identity, 48% coverage: 56:162/222 of query aligns to 166:278/307 of A1ADJ6
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
28% identity, 42% coverage: 70:162/222 of query aligns to 57:164/207 of 6x3cA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
28% identity, 42% coverage: 70:162/222 of query aligns to 57:164/211 of 4hurA
Sites not aligning to the query:
>8501107 FitnessBrowser__Miya:8501107
MPEQNTAFRRFQGVSFGKNVQILGLANVAIGQGSAIGDDTWINVCDRDDRLRLVIGQRVL
VGRQSMISAGGELEIGDFCLFAPRVFVSDADHVVDNISRPYSEQGFTRGKVVVEENCWLG
INTVITGSITVGRGCVVAANAVVTRDVPPFSVVAGVPAVILKMFNPATNAWEHVRTSEDS
ERIAAARTVHGLPSREEYRFILHRTSKVGHLSPLLVGSGQCL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory