SitesBLAST
Comparing 8501126 FitnessBrowser__Miya:8501126 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
34% identity, 98% coverage: 5:458/461 of query aligns to 12:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (= V69), G75 (= G71), S76 (≠ A72), G77 (= G73), T78 (= T74), G79 (≠ N75), L80 (= L76), A83 (≠ G79), C84 (≠ T80), P137 (= P134), G138 (= G135), E139 (≠ S136), A142 (≠ S140), T143 (= T141), G146 (= G144), N147 (= N145), S149 (≠ A147), T150 (≠ E148), A152 (= A150), G153 (= G151), E203 (= E201), G204 (= G202), I209 (≠ F207), E422 (= E417), H423 (= H418)
- binding fe (iii) ion: H377 (= H373), H384 (= H380), E422 (= E417)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 99% coverage: 6:460/461 of query aligns to 4:457/459 of P9WIT1
- K354 (≠ A352) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
32% identity, 99% coverage: 3:459/461 of query aligns to 2:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), W322 (≠ L328), E413 (= E417), H414 (= H418), N450 (= N454)
- binding lactic acid: R318 (= R324), H369 (= H373), H376 (= H380), H414 (= H418)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E413 (= E417)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ S33), P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), W323 (≠ L328), E414 (= E417), H415 (= H418), N451 (= N454)
- binding manganese (ii) ion: H370 (= H373), H377 (= H380), E414 (= E417)
- binding pyruvic acid: R319 (= R324), H370 (= H373), H377 (= H380), H415 (= H418)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R324), H369 (= H373), H376 (= H380), H414 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), W322 (≠ L328), E413 (= E417), H414 (= H418), N450 (= N454)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E413 (= E417)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ S77), R317 (= R324), W321 (≠ L328), H368 (= H373), H375 (= H380), H413 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), W321 (≠ L328), Y322 (≠ P329), E412 (= E417), H413 (= H418), N449 (= N454)
- binding manganese (ii) ion: H368 (= H373), H375 (= H380), E412 (= E417)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), H369 (= H373), E413 (= E417), N450 (= N454)
- binding deaminohydroxyvaline: R319 (= R324), H414 (= H418)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R324), W322 (≠ L328), H369 (= H373), H376 (= H380), H414 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), W322 (≠ L328), E413 (= E417), N450 (= N454)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E413 (= E417)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ S33), P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), W322 (≠ L328), E413 (= E417), H414 (= H418), N450 (= N454)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R324), H369 (= H373), H376 (= H380), H414 (= H418)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E413 (= E417)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), Y324 (≠ P329), H370 (= H373), E414 (= E417), N451 (= N454)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R324), W323 (≠ L328), H415 (= H418)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R324), W323 (≠ L328), H370 (= H373), H415 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), H370 (= H373), E414 (= E417), N451 (= N454)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R324), W323 (≠ L328), H415 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), Y324 (≠ P329), H370 (= H373), E414 (= E417), N451 (= N454)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), H370 (= H373), E414 (= E417), N451 (= N454)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R324), W323 (≠ L328), H415 (= H418)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), H370 (= H373), E414 (= E417), N451 (= N454)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R324), H415 (= H418)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), Y324 (≠ P329), H370 (= H373), E414 (= E417), N451 (= N454)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ S77), R319 (= R324), W323 (≠ L328), H415 (= H418)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R324), W322 (≠ L328), H369 (= H373), H376 (= H380), H413 (= H418)
- binding flavin-adenine dinucleotide: E32 (≠ S33), P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), W322 (≠ L328), E412 (= E417), H413 (= H418), N449 (= N454)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E412 (= E417)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
31% identity, 99% coverage: 3:459/461 of query aligns to 2:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R324), W322 (≠ L328), S336 (≠ L340), H369 (= H373), H376 (= H380), H413 (= H418)
- binding flavin-adenine dinucleotide: P68 (≠ R70), G70 (≠ A72), T71 (≠ G73), G72 (≠ T74), T73 (≠ N75), G74 (≠ L76), G78 (≠ T80), V79 (≠ I81), L90 (≠ T92), P132 (= P134), G133 (= G135), A134 (≠ S136), G140 (= G144), M141 (≠ N145), A143 (= A147), T144 (≠ E148), A146 (= A150), S147 (≠ G151), E200 (= E201), G201 (= G202), I206 (≠ F207), E412 (= E417), N449 (= N454)
- binding manganese (ii) ion: H369 (= H373), H376 (= H380), E412 (= E417)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
29% identity, 99% coverage: 3:459/461 of query aligns to 3:465/465 of 3pm9A
- active site: A149 (= A150), L159 (≠ V160)
- binding flavin-adenine dinucleotide: P69 (≠ V69), Q70 (≠ R70), G71 (= G71), G72 (≠ A72), N73 (≠ G73), T74 (= T74), G75 (≠ N75), L76 (= L76), G79 (= G79), Q80 (≠ T80), L91 (≠ T92), L133 (≠ P134), G134 (= G135), A135 (≠ S136), C139 (≠ S140), T140 (= T141), G142 (= G143), G143 (= G144), S146 (≠ A147), T147 (≠ E148), A149 (= A150), G150 (= G151), E200 (= E201), G201 (= G202), I205 (≠ V206), I206 (≠ F207), E423 (= E417)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
27% identity, 90% coverage: 43:459/461 of query aligns to 50:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ V69), G78 (= G71), G79 (≠ A72), N80 (≠ G73), T81 (= T74), G82 (≠ N75), M83 (≠ L76), G86 (= G79), S87 (≠ T80), L140 (≠ P134), A142 (≠ S136), C146 (≠ S140), H147 (≠ T141), G150 (= G144), N151 (= N145), A153 (= A147), T154 (≠ E148), G208 (= G202), I212 (≠ V206), I213 (≠ F207), E423 (= E417), N460 (= N454)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
27% identity, 90% coverage: 43:459/461 of query aligns to 49:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R324), T337 (≠ L328), K348 (≠ R347), Y379 (≠ F371), H381 (= H373), H388 (= H380), H423 (= H418)
- binding flavin-adenine dinucleotide: P75 (≠ V69), Q76 (≠ R70), G77 (= G71), G78 (≠ A72), N79 (≠ G73), T80 (= T74), G81 (≠ N75), M82 (≠ L76), G85 (= G79), S86 (≠ T80), L139 (≠ P134), G140 (= G135), A141 (≠ S136), C145 (≠ S140), G149 (= G144), N150 (= N145), A152 (= A147), T153 (≠ E148), G157 (= G152), G207 (= G202), I212 (≠ F207), E422 (= E417), N459 (= N454)
- binding zinc ion: H381 (= H373), H388 (= H380), E422 (= E417)
Sites not aligning to the query:
Query Sequence
>8501126 FitnessBrowser__Miya:8501126
MPSAALIKEFEAVVGKDNVFTSEADRQSYSYDSAVLEAVVPALVVRPTTTEQLGKVVRLC
NENGNPITVRGAGTNLSGGTIPDPREGIVILTNSLNRIIEINEEDLYAVVEPGVVTAKFA
AEVAKRGLFYPPDPGSQAVSTLGGNVAENAGGLRGLKYGVTKDYVMGIEFFDVNGGLVKT
GSRTVKCVTGYNLAGLMVASEGTLGVFSNIVLKLVPPPQASKAMMAVFDDVNKASEAVAG
IIAAHVVPCTLEFMDQATIRYVDDFTKAGLPRDAQAILLIEVDGHAGQVAEDAEKVEKVL
NKVGATEIKVAKDAAEKFKLWEARRNALPALARAKPTTVLEDATVPRSKIPAMVKAINDI
AAKYNISIGTFGHAGDGNLHPTILCDRRDKHEFERVEHAVDEIFDVALSLHGTLSGEHGI
GMAKSKWMEKETSKATIEFSRNMKRAIDPKYILNPGKIIGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory