Comparing 8501147 FitnessBrowser__Miya:8501147 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
5yumA Crystallographic structures of ilvn.Val/ile complexes:conformational selectivity for feedback inhibition of ahass (see paper)
60% identity, 69% coverage: 25:108/121 of query aligns to 4:87/91 of 5yumA
5yppE Crystal structure of ilvn.Val-1a (see paper)
60% identity, 69% coverage: 25:108/121 of query aligns to 4:87/91 of 5yppE
A0QUX7 Acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 62% coverage: 20:94/121 of query aligns to 3:78/170 of A0QUX7
P9WKJ3 Putative acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS; EC 2.2.1.6 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 56% coverage: 27:94/121 of query aligns to 8:76/168 of P9WKJ3
6vz8G Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
39% identity, 57% coverage: 26:94/121 of query aligns to 5:74/159 of 6vz8G
Q93YZ7 Acetolactate synthase small subunit 1, chloroplastic; ALS-interacting protein 1; Acetohydroxyacid synthase small subunit 1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
39% identity, 56% coverage: 27:94/121 of query aligns to 322:390/491 of Q93YZ7
Sites not aligning to the query:
Q9FFF4 Acetolactate synthase small subunit 2, chloroplastic; ALS-interacting protein 3; Acetohydroxy-acid synthase small subunit 2; Protein valine-tolerant 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 57% coverage: 27:95/121 of query aligns to 310:379/477 of Q9FFF4
Sites not aligning to the query:
2pc6A Crystal structure of putative acetolactate synthase- small subunit from nitrosomonas europaea (see paper)
33% identity, 65% coverage: 27:105/121 of query aligns to 6:83/164 of 2pc6A
6u9dL Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
35% identity, 55% coverage: 27:93/121 of query aligns to 40:110/255 of 6u9dL
Sites not aligning to the query:
O60086 Probable acetolactate synthase small subunit; Acetohydroxy-acid synthase small subunit; AHAS; ALS from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 50% coverage: 31:91/121 of query aligns to 77:138/289 of O60086
Sites not aligning to the query:
6wo1B Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
35% identity, 56% coverage: 26:93/121 of query aligns to 6:77/197 of 6wo1B
>8501147 FitnessBrowser__Miya:8501147
MPDTATLSPRPACPAALAPDARPLVALRLTVNNHPGVMSHVCGLFARRAFNVEAILCTPV
NGGEVSRIWLLVAEDERLEQMVRQVRKLHDVLDVRRRPAGGEGFARLAECMAAWERETAG
Q
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory