Comparing 8501162 FitnessBrowser__Miya:8501162 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
39% identity, 51% coverage: 109:222/223 of query aligns to 75:184/186 of 4isxA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
38% identity, 51% coverage: 109:222/223 of query aligns to 75:184/190 of 5u2kA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 54% coverage: 103:222/223 of query aligns to 70:185/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
33% identity, 54% coverage: 103:222/223 of query aligns to 69:184/200 of 1krrA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
33% identity, 54% coverage: 103:222/223 of query aligns to 69:184/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
33% identity, 54% coverage: 103:222/223 of query aligns to 69:184/201 of 1kruA
Sites not aligning to the query:
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
40% identity, 43% coverage: 127:222/223 of query aligns to 73:184/185 of 3nz2J
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
40% identity, 43% coverage: 127:222/223 of query aligns to 70:181/183 of 3nz2C
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
40% identity, 43% coverage: 127:222/223 of query aligns to 63:174/176 of 3ectA
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
35% identity, 51% coverage: 109:222/223 of query aligns to 77:186/188 of 3igjC
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
50% identity, 24% coverage: 168:221/223 of query aligns to 113:166/204 of 1mrlA
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
50% identity, 24% coverage: 168:221/223 of query aligns to 113:166/203 of 3dhoA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
50% identity, 24% coverage: 168:221/223 of query aligns to 113:166/205 of 1kk4A
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
50% identity, 24% coverage: 168:221/223 of query aligns to 113:166/209 of P50870
Sites not aligning to the query:
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
50% identity, 24% coverage: 168:221/223 of query aligns to 113:166/206 of 1khrA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
46% identity, 24% coverage: 168:221/223 of query aligns to 112:165/206 of 6x3jA
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
46% identity, 24% coverage: 168:221/223 of query aligns to 112:165/212 of 4husA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
46% identity, 24% coverage: 168:221/223 of query aligns to 112:165/207 of 6x3cA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
46% identity, 24% coverage: 168:221/223 of query aligns to 112:165/203 of 6x3cE
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
46% identity, 24% coverage: 168:221/223 of query aligns to 112:165/211 of 4hurA
Sites not aligning to the query:
>8501162 FitnessBrowser__Miya:8501162
MGGFITRALRKVREEGLTPRDIVSYGCMAVHRTASCLWGTVRMRLKAALFGVRLGGGCEC
CGTIILQRWPGSRIELGRGVGIISSSRRCTSATIHAPTRLRTFAGSAAILVGDGVTMNGT
AITARSRTIRIGKGTMIGPNCVITDSDFHAPWPPETRLTTPAFERDRDVTIGDNVWLGMR
CIVLKGVTIGDGAIVAAGSVVTRDVPPATLVAGTPARVVRQLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory