Comparing 8501167 FitnessBrowser__Miya:8501167 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
34% identity, 66% coverage: 61:200/212 of query aligns to 11:166/211 of 4hurA
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
34% identity, 66% coverage: 61:200/212 of query aligns to 11:166/206 of 6x3jA
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
34% identity, 66% coverage: 61:200/212 of query aligns to 11:166/212 of 4husA
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
34% identity, 66% coverage: 61:200/212 of query aligns to 11:166/207 of 6x3cA
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
34% identity, 66% coverage: 61:200/212 of query aligns to 11:166/203 of 6x3cE
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
41% identity, 52% coverage: 88:198/212 of query aligns to 75:182/185 of 3nz2J
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
40% identity, 53% coverage: 88:199/212 of query aligns to 65:173/176 of 3ectA
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
40% identity, 53% coverage: 88:199/212 of query aligns to 72:180/183 of 3nz2C
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
35% identity, 44% coverage: 108:200/212 of query aligns to 60:167/203 of 3dhoA
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
35% identity, 44% coverage: 108:200/212 of query aligns to 60:167/209 of P50870
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
35% identity, 44% coverage: 108:200/212 of query aligns to 60:167/206 of 1khrA
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
35% identity, 44% coverage: 108:200/212 of query aligns to 60:167/204 of 1mrlA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
35% identity, 44% coverage: 108:200/212 of query aligns to 60:167/205 of 1kk4A
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
39% identity, 53% coverage: 88:199/212 of query aligns to 75:183/186 of 4isxA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
34% identity, 53% coverage: 88:199/212 of query aligns to 75:183/190 of 5u2kA
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
34% identity, 45% coverage: 105:200/212 of query aligns to 55:165/210 of 6pubA
Sites not aligning to the query:
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
34% identity, 45% coverage: 105:200/212 of query aligns to 52:162/206 of 6u9cA
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
52% identity, 26% coverage: 145:200/212 of query aligns to 107:162/208 of 2xatA
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
41% identity, 48% coverage: 97:198/212 of query aligns to 86:184/188 of 3igjC
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 56% coverage: 82:199/212 of query aligns to 70:184/203 of P07464
Sites not aligning to the query:
>8501167 FitnessBrowser__Miya:8501167
MPTPHMPRMPDMSRLAAIAEELWLSLFAWIPTVIGVGARLVAWQPLFCHCGRVRFGQSVT
VQGCRNIALADGVRIGKGCHLYARTGALEMAENAALNVNVVVDADGGHIRMGAHVTVGPG
TVIRAANHNFDRTDVPIMFQGHEYGEVTIEDDVWIAANCTITPGVHIGRGAVVGAGAVVT
KDVEPYTVVGGVPARPLRKRGVHERAATPPEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory