Comparing 8501181 FitnessBrowser__Miya:8501181 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
B0SR19 Sugar transporter SemiSWEET from Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) (see paper)
38% identity, 84% coverage: 16:97/98 of query aligns to 3:84/85 of B0SR19
5uhsA Structure of a semisweet d57a mutant (see paper)
39% identity, 79% coverage: 16:92/98 of query aligns to 3:79/81 of 5uhsA
>8501181 FitnessBrowser__Miya:8501181
MPAPTADSAALSTLFEIIGYAAGLLTSLAYLPQVVRIARTRSADDISLPTFRLLAVGVAL
WLVYGIGIGSWPVMAANAVGLALILAVIWLKLRYSRQL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory