Comparing 8501184 FitnessBrowser__Miya:8501184 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
54% identity, 90% coverage: 24:246/248 of query aligns to 3:225/226 of 8eyzA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
49% identity, 90% coverage: 22:243/248 of query aligns to 2:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
48% identity, 90% coverage: 22:243/248 of query aligns to 2:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
43% identity, 88% coverage: 26:242/248 of query aligns to 12:228/229 of 5t0wA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
40% identity, 88% coverage: 24:242/248 of query aligns to 14:234/235 of 4g4pA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 91% coverage: 21:246/248 of query aligns to 2:228/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 91% coverage: 21:246/248 of query aligns to 8:234/241 of 2q2aA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 90% coverage: 24:246/248 of query aligns to 1:224/231 of 2q2cA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
41% identity, 79% coverage: 47:242/248 of query aligns to 18:210/217 of 2pyyB
Sites not aligning to the query:
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
38% identity, 88% coverage: 26:243/248 of query aligns to 12:228/229 of 6svfA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
35% identity, 87% coverage: 27:242/248 of query aligns to 9:226/230 of 4kqpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
36% identity, 88% coverage: 26:242/248 of query aligns to 3:222/224 of 4ymxA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
35% identity, 86% coverage: 24:237/248 of query aligns to 16:231/239 of 4zefA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
35% identity, 88% coverage: 25:242/248 of query aligns to 9:231/237 of 4i62A
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
31% identity, 90% coverage: 21:242/248 of query aligns to 1:226/234 of 3k4uE
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
33% identity, 86% coverage: 28:241/248 of query aligns to 4:219/223 of 8b5dA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
32% identity, 89% coverage: 22:241/248 of query aligns to 1:222/226 of 6fxgB
8b5eA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
32% identity, 86% coverage: 28:241/248 of query aligns to 6:221/225 of 8b5eA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
36% identity, 79% coverage: 48:242/248 of query aligns to 38:234/243 of 5eyfB
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
34% identity, 85% coverage: 25:235/248 of query aligns to 12:228/240 of 4h5fA
>8501184 FitnessBrowser__Miya:8501184
MKRLIQIALGLALVAALCAPAMAKKLVVAHDTNFKPFEFKGEDGKYTGFDIELWQAVAKI
VGVEYELQPMDFNGIIPGLQTGNIDVGIAGITIKAERQQVIDFSDPYYDSGLMILVREGD
TAIKSVEDLKGKIVATKTATSSVDFVKACASAKEVKLFPNNDGMFFELMSGGADAVVFDM
PVVKEFAMTAGKGKVKTVGPLYQGQSYGIGFPKGSPLVAKVNEALKKAKADGTYEKLYIK
WFGYAPGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory