Comparing 8501198 DvMF_1932 TRAP dicarboxylate transporter, DctP subunit (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
32% identity, 81% coverage: 33:303/335 of query aligns to 7:272/303 of 4p9kA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
32% identity, 81% coverage: 33:303/335 of query aligns to 8:273/304 of 4pakA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
31% identity, 85% coverage: 32:317/335 of query aligns to 4:282/303 of 4pddA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
30% identity, 90% coverage: 32:333/335 of query aligns to 3:300/300 of 4n8yA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
32% identity, 80% coverage: 32:300/335 of query aligns to 4:267/301 of 4nq8B
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
29% identity, 91% coverage: 29:334/335 of query aligns to 3:304/304 of 4x8rA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
31% identity, 81% coverage: 33:303/335 of query aligns to 5:270/301 of 4pdhA
4n91A Crystal structure of a trap periplasmic solute binding protein from anaerococcus prevotii dsm 20548 (apre_1383), target efi-510023, with bound alpha/beta d-glucuronate (see paper)
29% identity, 74% coverage: 29:276/335 of query aligns to 1:245/308 of 4n91A
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
30% identity, 91% coverage: 31:334/335 of query aligns to 2:300/301 of 4mhfA
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
30% identity, 91% coverage: 31:334/335 of query aligns to 2:300/302 of 4mijA
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
30% identity, 91% coverage: 31:334/335 of query aligns to 32:330/330 of Q128M1
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
27% identity, 84% coverage: 34:316/335 of query aligns to 6:280/304 of 4xeqB
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
29% identity, 87% coverage: 29:320/335 of query aligns to 9:291/310 of 7bbrA
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
28% identity, 90% coverage: 32:334/335 of query aligns to 3:299/303 of 4p3lA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
29% identity, 87% coverage: 29:320/335 of query aligns to 8:290/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
29% identity, 87% coverage: 29:320/335 of query aligns to 8:290/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
29% identity, 87% coverage: 29:320/335 of query aligns to 8:290/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
29% identity, 87% coverage: 29:320/335 of query aligns to 8:290/310 of 7bcnA
4ovqA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d- glucuronate (see paper)
31% identity, 70% coverage: 45:278/335 of query aligns to 16:245/302 of 4ovqA
Sites not aligning to the query:
4o8mA Crystal structure of a trap periplasmic solute binding protein actinobacillus succinogenes 130z, target efi-510004, with bound l- galactonate (see paper)
31% identity, 86% coverage: 31:317/335 of query aligns to 3:288/303 of 4o8mA
>8501198 DvMF_1932 TRAP dicarboxylate transporter, DctP subunit (RefSeq)
MKRAAMLVAALLMTVALAAPVQAAYDGPKIKFRLAHTTPPGNHITLAYQKFADLVAEKSG
GKITVQVFPNAILGSDRVLVEGAQKGTLEIGVSSTPNLANFSKLYSVFDLPYITSPKFQK
NLYSAIDPGGTLYDYFLKVANDVGLQPIMYAEYGYRHFVSVKRPLGKASDLAGLKMRTTD
SPVEVGVAKALNTNPSPIAWGEVYTALQQGTIDAEGNTFPHLFGAKHHEVLKYAITSAHN
YCMQVAMANKAWWDGLPDAAKQVINAAAREATQYQRDVLYPENEKAAREGFIKAGITIHD
ATDAEIDEFRKLTRPVWDTVTLPAELIKLVQDTQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory