SitesBLAST
Comparing 8501200 FitnessBrowser__Miya:8501200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1powA The refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum (see paper)
28% identity, 94% coverage: 9:553/580 of query aligns to 8:543/585 of 1powA
- active site: I24 (= I25), G26 (= G27), G27 (≠ S28), S28 (≠ A29), I29 (≠ F30), E51 (= E50), S74 (≠ Q73), F113 (= F112), Q114 (= Q113), E115 (= E114), V162 (≠ R161), R256 (≠ Y255), E283 (≠ T283), V386 (≠ I398), A412 (≠ G424), M414 (≠ T426), D439 (= D451), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), F471 (≠ A483), I472 (≠ E484), E475 (≠ N487), G538 (= G548)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ R210), G214 (= G211), T236 (= T235), Y237 (= Y236), A254 (≠ I253), V257 (≠ M256), G276 (= G275), N277 (≠ T276), N278 (≠ R277), Y279 (≠ L278), P280 (≠ S279), F281 (= F281), D298 (= D302), I299 (= I303), K303 (≠ H307), D317 (= D321), A318 (= A322), N409 (≠ L421)
- binding magnesium ion: D439 (= D451), N466 (= N478), Q468 (≠ A480)
- binding thiamine diphosphate: D388 (≠ N400), M414 (≠ T426), G440 (= G452), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), G470 (≠ C482), F471 (≠ A483), I472 (≠ E484)
2ezuA Pyruvate oxidase variant f479w in complex with reaction intermediate 2-acetyl-thiamin diphosphate (see paper)
28% identity, 94% coverage: 9:553/580 of query aligns to 8:543/585 of 2ezuA
- active site: I24 (= I25), G26 (= G27), G27 (≠ S28), S28 (≠ A29), I29 (≠ F30), E51 (= E50), S74 (≠ Q73), F113 (= F112), Q114 (= Q113), E115 (= E114), V162 (≠ R161), R256 (≠ Y255), E283 (≠ T283), V386 (≠ I398), A412 (≠ G424), M414 (≠ T426), D439 (= D451), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), W471 (≠ A483), I472 (≠ E484), E475 (≠ N487), G538 (= G548)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ R210), G214 (= G211), T236 (= T235), Y237 (= Y236), P238 (≠ L237), A254 (≠ I253), N255 (≠ G254), R256 (≠ Y255), V257 (≠ M256), G276 (= G275), N277 (≠ T276), N278 (≠ R277), P280 (≠ S279), F281 (= F281), D298 (= D302), I299 (= I303), K303 (≠ H307), D317 (= D321), A318 (= A322), N409 (≠ L421)
- binding 2-acetyl-thiamine diphosphate: V386 (≠ I398), D388 (≠ N400), M414 (≠ T426), G438 (= G450), G440 (= G452), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), G470 (≠ C482), W471 (≠ A483), I472 (≠ E484)
- binding magnesium ion: D439 (= D451), N466 (= N478), Q468 (≠ A480)
Sites not aligning to the query:
2ez9A Pyruvate oxidase variant f479w in complex with reaction intermediate analogue 2-phosphonolactyl-thiamin diphosphate (see paper)
28% identity, 94% coverage: 9:553/580 of query aligns to 8:543/585 of 2ez9A
- active site: I24 (= I25), G26 (= G27), G27 (≠ S28), S28 (≠ A29), I29 (≠ F30), E51 (= E50), S74 (≠ Q73), F113 (= F112), Q114 (= Q113), E115 (= E114), V162 (≠ R161), R256 (≠ Y255), E283 (≠ T283), V386 (≠ I398), A412 (≠ G424), M414 (≠ T426), D439 (= D451), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), W471 (≠ A483), I472 (≠ E484), E475 (≠ N487), G538 (= G548)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ R210), G214 (= G211), T236 (= T235), Y237 (= Y236), P238 (≠ L237), A254 (≠ I253), N255 (≠ G254), R256 (≠ Y255), V257 (≠ M256), G276 (= G275), N277 (≠ T276), N278 (≠ R277), P280 (≠ S279), F281 (= F281), D298 (= D302), I299 (= I303), K303 (≠ H307), D317 (= D321), A318 (= A322), N409 (≠ L421)
- binding magnesium ion: D439 (= D451), N466 (= N478), Q468 (≠ A480)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1s)-1-hydroxy-1-[(r)-hydroxy(methoxy)phosphoryl]ethyl}-5-(2-{[(s)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: V386 (≠ I398), D388 (≠ N400), M414 (≠ T426), G438 (= G450), G440 (= G452), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), G470 (≠ C482), W471 (≠ A483), I472 (≠ E484), E475 (≠ N487)
2ez8A Pyruvate oxidase variant f479w in complex with reaction intermediate 2-lactyl-thiamin diphosphate (see paper)
28% identity, 94% coverage: 9:553/580 of query aligns to 8:543/585 of 2ez8A
- active site: I24 (= I25), G26 (= G27), G27 (≠ S28), S28 (≠ A29), I29 (≠ F30), E51 (= E50), S74 (≠ Q73), F113 (= F112), Q114 (= Q113), E115 (= E114), V162 (≠ R161), R256 (≠ Y255), E283 (≠ T283), V386 (≠ I398), A412 (≠ G424), M414 (≠ T426), D439 (= D451), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), W471 (≠ A483), I472 (≠ E484), E475 (≠ N487), G538 (= G548)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ R210), G214 (= G211), T236 (= T235), Y237 (= Y236), P238 (≠ L237), A254 (≠ I253), N255 (≠ G254), R256 (≠ Y255), V257 (≠ M256), G276 (= G275), N277 (≠ T276), N278 (≠ R277), P280 (≠ S279), F281 (= F281), D298 (= D302), I299 (= I303), K303 (≠ H307), D317 (= D321), A318 (= A322), N390 (≠ S402), N409 (≠ L421)
- binding magnesium ion: D439 (= D451), N466 (= N478), Q468 (≠ A480)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-carboxy-1-hydroxyethyl)-5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: D388 (≠ N400), M414 (≠ T426), G438 (= G450), G440 (= G452), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), G470 (≠ C482), W471 (≠ A483), I472 (≠ E484)
Sites not aligning to the query:
2ez4B Pyruvate oxidase variant f479w (see paper)
28% identity, 94% coverage: 9:553/580 of query aligns to 8:543/585 of 2ez4B
- active site: I24 (= I25), G26 (= G27), G27 (≠ S28), S28 (≠ A29), I29 (≠ F30), E51 (= E50), S74 (≠ Q73), F113 (= F112), Q114 (= Q113), E115 (= E114), V162 (≠ R161), R256 (≠ Y255), E283 (≠ T283), V386 (≠ I398), A412 (≠ G424), M414 (≠ T426), D439 (= D451), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), W471 (≠ A483), I472 (≠ E484), E475 (≠ N487), G538 (= G548)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ R210), G214 (= G211), T236 (= T235), Y237 (= Y236), P238 (≠ L237), A254 (≠ I253), N255 (≠ G254), R256 (≠ Y255), V257 (≠ M256), G276 (= G275), N277 (≠ T276), N278 (≠ R277), P280 (≠ S279), F281 (= F281), D298 (= D302), I299 (= I303), K303 (≠ H307), D317 (= D321), A318 (= A322), N409 (≠ L421)
- binding magnesium ion: D439 (= D451), N466 (= N478), Q468 (≠ A480)
- binding phosphate ion: W471 (≠ A483), E475 (≠ N487)
- binding thiamine diphosphate: D388 (≠ N400), A412 (≠ G424), M414 (≠ T426), G438 (= G450), D439 (= D451), G440 (= G452), G441 (≠ A453), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), G470 (≠ C482), W471 (≠ A483), I472 (≠ E484)
4feeA High-resolution structure of pyruvate oxidase in complex with reaction intermediate 2-hydroxyethyl-thiamin diphosphate carbanion-enamine, crystal b (see paper)
28% identity, 94% coverage: 9:553/580 of query aligns to 8:543/586 of 4feeA
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ R210), G214 (= G211), T236 (= T235), Y237 (= Y236), P238 (≠ L237), A254 (≠ I253), N255 (≠ G254), V257 (≠ M256), G276 (= G275), N277 (≠ T276), N278 (≠ R277), P280 (≠ S279), F281 (= F281), D298 (= D302), I299 (= I303), K303 (≠ H307), D317 (= D321), A318 (= A322), N390 (≠ S402), N409 (≠ L421)
- binding magnesium ion: D439 (= D451), N466 (= N478), Q468 (≠ A480)
- binding pyruvic acid: N255 (≠ G254), R256 (≠ Y255)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V386 (≠ I398), D388 (≠ N400), A412 (≠ G424), M414 (≠ T426), G438 (= G450), G440 (= G452), N466 (= N478), Q468 (≠ A480), Y469 (≠ W481), G470 (≠ C482), F471 (≠ A483), I472 (≠ E484)
Sites not aligning to the query:
6lpiB Crystal structure of ahas holo-enzyme (see paper)
31% identity, 85% coverage: 3:494/580 of query aligns to 5:471/539 of 6lpiB
- active site: I27 (= I25), G29 (= G27), G30 (≠ S28), S31 (≠ A29), I32 (≠ F30), E53 (= E50), C76 (≠ Q73), F115 (= F112), Q116 (= Q113), E117 (= E114), K165 (≠ R161), M256 (≠ Y255), A283 (≠ Y280), V375 (≠ I398), G401 (= G424), M403 (≠ T426), D428 (= D451), N455 (= N478), A457 (= A480), L458 (≠ W481), L460 (≠ A483), V461 (≠ E484), Q464 (≠ N487)
- binding flavin-adenine dinucleotide: R155 (= R152), G212 (= G209), G213 (≠ R210), G214 (= G211), T236 (= T235), L237 (≠ Y236), M238 (≠ L237), L254 (≠ I253), M256 (≠ Y255), H257 (≠ M256), G276 (= G275), A277 (≠ T276), R278 (= R277), D280 (≠ S279), R282 (vs. gap), A283 (≠ Y280), D300 (= D302), I301 (= I303), D319 (= D321), V320 (≠ A322), M380 (≠ S403), G398 (≠ L421)
- binding magnesium ion: D428 (= D451), N455 (= N478)
- binding thiamine diphosphate: E53 (= E50), C76 (≠ Q73), P79 (= P76), G376 (= G399), Q377 (≠ N400), H378 (≠ T401), G401 (= G424), M403 (≠ T426), G427 (= G450), D428 (= D451), G429 (= G452), S430 (≠ A453), M433 (= M456), N455 (= N478), A457 (= A480), L458 (≠ W481), G459 (≠ C482), L460 (≠ A483), V461 (≠ E484)
7egvA Acetolactate synthase from trichoderma harzianum with inhibitor harzianic acid (see paper)
27% identity, 93% coverage: 8:547/580 of query aligns to 11:549/590 of 7egvA
- active site: Y28 (≠ I25), G30 (= G27), G31 (≠ S28), A32 (= A29), I33 (≠ F30), E54 (= E50), T77 (≠ Q73), F116 (= F112), Q117 (= Q113), K166 (≠ R161), E220 (= E219), M256 (≠ Y255), V283 (≠ Y280), V400 (≠ I398), L425 (≠ F423), G426 (= G424), M428 (≠ T426), Q483 (≠ W481), M485 (≠ A483), V486 (≠ E484), W489 (≠ N487), L511 (≠ I509), G516 (= G514), I517 (≠ A515)
- binding flavin-adenine dinucleotide: R156 (= R152), G209 (= G209), Q210 (≠ R210), G211 (= G211), T236 (= T235), L237 (≠ Y236), H238 (≠ L237), G276 (= G275), S277 (≠ T276), R278 (= R277), D280 (≠ S279), R282 (vs. gap), V283 (≠ Y280), E309 (≠ D302), I310 (= I303), D328 (= D321), V329 (≠ A322), M405 (≠ S403), G423 (≠ L421), G424 (≠ T422)
- binding (2S)-3-methyl-2-[[(2S,4R)-1-methyl-4-[(2E,4E)-octa-2,4-dienoyl]-3,5-bis(oxidanylidene)pyrrolidin-2-yl]methyl]-2-oxidanyl-butanoic acid: F493 (= F491), Y494 (= Y492)
- binding magnesium ion: D453 (= D451), N480 (= N478), E482 (≠ A480)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: P29 (≠ L26), E54 (= E50), Q117 (= Q113), V400 (≠ I398), G401 (= G399), Q402 (≠ N400), H403 (≠ T401), G426 (= G424), M428 (≠ T426), D453 (= D451), A454 (≠ G452), S455 (≠ A453), E482 (≠ A480), Q483 (≠ W481), G484 (≠ C482), M485 (≠ A483), V486 (≠ E484)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
27% identity, 94% coverage: 4:547/580 of query aligns to 10:558/599 of 1n0hA
- active site: Y31 (≠ I25), G33 (= G27), G34 (≠ S28), A35 (= A29), I36 (≠ F30), E57 (= E50), T80 (≠ Q73), F119 (= F112), Q120 (= Q113), E121 (= E114), K169 (≠ R161), R230 (≠ E219), M266 (≠ Y255), V293 (≠ Y280), V409 (≠ I398), L434 (≠ F423), G435 (= G424), M437 (≠ T426), D462 (= D451), N489 (= N478), E491 (≠ A480), Q492 (≠ W481), M494 (≠ A483), V495 (≠ E484), W498 (≠ N487), L520 (≠ I509), G525 (= G514), L526 (≠ A515)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (≠ I398), G410 (= G399), Q411 (≠ N400), H412 (≠ T401), G435 (= G424), M437 (≠ T426), G461 (= G450), D462 (= D451), A463 (≠ G452), S464 (≠ A453), M467 (= M456), N489 (= N478), E491 (≠ A480), Q492 (≠ W481), G493 (≠ C482), V495 (≠ E484)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (≠ S28), A35 (= A29), V109 (≠ A102), P110 (≠ G103), F119 (= F112), K169 (≠ R161), M266 (≠ Y255), D291 (vs. gap), R292 (vs. gap), V495 (≠ E484), W498 (≠ N487)
- binding flavin-adenine dinucleotide: R159 (= R152), G219 (= G209), A220 (≠ R210), G221 (= G211), N224 (≠ D214), T246 (= T235), L247 (≠ Y236), Q248 (≠ L237), L264 (≠ I253), G265 (= G254), M266 (≠ Y255), H267 (≠ M256), G286 (= G275), A287 (≠ T276), R288 (= R277), D290 (≠ S279), R292 (vs. gap), V293 (≠ Y280), E319 (≠ D302), V320 (≠ I303), N324 (≠ H307), G337 (≠ A320), D338 (= D321), A339 (= A322), M414 (≠ S403), G432 (≠ L421), G433 (≠ T422)
- binding magnesium ion: D462 (= D451), N489 (= N478), E491 (≠ A480)
- binding thiamine diphosphate: Y31 (≠ I25), E57 (= E50), P83 (= P76)
Sites not aligning to the query:
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
26% identity, 94% coverage: 4:547/580 of query aligns to 8:550/591 of 5wkcA
- active site: Y29 (≠ I25), G31 (= G27), G32 (≠ S28), A33 (= A29), I34 (≠ F30), E55 (= E50), T78 (≠ Q73), F117 (= F112), Q118 (= Q113), E119 (= E114), K167 (≠ R161), R222 (≠ E219), M258 (≠ Y255), V285 (≠ Y280), V401 (≠ I398), L426 (≠ F423), G427 (= G424), M429 (≠ T426), D454 (= D451), N481 (= N478), E483 (≠ A480), Q484 (≠ W481), M486 (≠ A483), V487 (≠ E484), W490 (≠ N487), L512 (≠ I509), G517 (= G514), L518 (≠ A515)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (≠ I398), G402 (= G399), Q403 (≠ N400), H404 (≠ T401), G427 (= G424), M429 (≠ T426), G453 (= G450), D454 (= D451), A455 (≠ G452), S456 (≠ A453), M459 (= M456), N481 (= N478), E483 (≠ A480), Q484 (≠ W481), G485 (≠ C482), M486 (≠ A483), V487 (≠ E484)
- binding ethaneperoxoic acid: G32 (≠ S28), Q118 (= Q113)
- binding flavin-adenine dinucleotide: R157 (= R152), G211 (= G209), A212 (≠ R210), G213 (= G211), N216 (≠ D214), T238 (= T235), L239 (≠ Y236), Q240 (≠ L237), L256 (≠ I253), M258 (≠ Y255), G278 (= G275), A279 (≠ T276), R280 (= R277), R284 (vs. gap), V285 (≠ Y280), E311 (≠ D302), V312 (≠ I303), N316 (≠ H307), D330 (= D321), A331 (= A322), M406 (≠ S403), G424 (≠ L421)
- binding magnesium ion: D454 (= D451), N481 (= N478), E483 (≠ A480)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (≠ S28), A33 (= A29), V107 (≠ A102), F117 (= F112), K167 (≠ R161), M258 (≠ Y255), R284 (vs. gap), M486 (≠ A483), W490 (≠ N487)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (≠ L26), E55 (= E50)
Sites not aligning to the query:
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
27% identity, 94% coverage: 4:547/580 of query aligns to 10:552/593 of 6deoA
- active site: Y31 (≠ I25), G33 (= G27), G34 (≠ S28), A35 (= A29), I36 (≠ F30), E57 (= E50), T80 (≠ Q73), F119 (= F112), Q120 (= Q113), E121 (= E114), K169 (≠ R161), K224 (≠ E219), M260 (≠ Y255), V287 (≠ P285), V403 (≠ I398), L428 (≠ F423), G429 (= G424), M431 (≠ T426), D456 (= D451), N483 (= N478), E485 (≠ A480), Q486 (≠ W481), M488 (≠ A483), V489 (≠ E484), W492 (≠ N487), L514 (≠ I509), N519 (≠ G514), V520 (≠ A515)
- binding flavin-adenine dinucleotide: R159 (= R152), G213 (= G209), A214 (≠ R210), G215 (= G211), N218 (≠ D214), T240 (= T235), L241 (≠ Y236), Q242 (≠ L237), L258 (≠ I253), G280 (= G275), A281 (≠ T276), R282 (= R277), D284 (≠ G282), R286 (≠ L284), V287 (≠ P285), E313 (≠ D302), I314 (= I303), N318 (≠ H307), D332 (= D321), V333 (≠ A322), M408 (≠ S403), G426 (≠ L421)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (≠ Y255), D285 (≠ T283), R286 (≠ L284), M488 (≠ A483), W492 (≠ N487)
- binding magnesium ion: D456 (= D451), N483 (= N478), E485 (≠ A480)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (≠ I398), G404 (= G399), Q405 (≠ N400), H406 (≠ T401), G429 (= G424), M431 (≠ T426), G455 (= G450), D456 (= D451), A457 (≠ G452), S458 (≠ A453), M461 (= M456), N483 (= N478), E485 (≠ A480), Q486 (≠ W481), G487 (≠ C482), M488 (≠ A483), V489 (≠ E484)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
27% identity, 94% coverage: 4:547/580 of query aligns to 8:555/596 of 1t9cA
- active site: Y29 (≠ I25), G31 (= G27), G32 (≠ S28), A33 (= A29), I34 (≠ F30), E55 (= E50), T78 (≠ Q73), F117 (= F112), Q118 (= Q113), E119 (= E114), K167 (≠ R161), R227 (≠ E219), M263 (≠ Y255), V290 (≠ Y280), V406 (≠ I398), L431 (≠ F423), G432 (= G424), M434 (≠ T426), D459 (= D451), N486 (= N478), E488 (≠ A480), Q489 (≠ W481), M491 (≠ A483), V492 (≠ E484), W495 (≠ N487), L517 (≠ I509), G522 (= G514), L523 (≠ A515)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ S28), V107 (≠ A102), P108 (≠ G103), F117 (= F112), K167 (≠ R161), D288 (vs. gap), R289 (vs. gap), W495 (≠ N487)
- binding flavin-adenine dinucleotide: R157 (= R152), G216 (= G209), A217 (≠ R210), G218 (= G211), N221 (≠ D214), T243 (= T235), L244 (≠ Y236), Q245 (≠ L237), L261 (≠ I253), M263 (≠ Y255), H264 (≠ M256), G283 (= G275), A284 (≠ T276), R285 (= R277), D287 (≠ S279), R289 (vs. gap), V290 (≠ Y280), E316 (≠ D302), V317 (≠ I303), N321 (≠ H307), G334 (≠ A320), D335 (= D321), A336 (= A322), M411 (≠ S403), G429 (≠ L421), G430 (≠ T422)
- binding magnesium ion: D459 (= D451), N486 (= N478), E488 (≠ A480)
Sites not aligning to the query:
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
26% identity, 94% coverage: 4:547/580 of query aligns to 8:554/595 of 1t9bB
- active site: Y29 (≠ I25), G31 (= G27), G32 (≠ S28), A33 (= A29), I34 (≠ F30), E55 (= E50), T78 (≠ Q73), F117 (= F112), Q118 (= Q113), E119 (= E114), K167 (≠ R161), R226 (≠ E219), M262 (≠ Y255), V289 (≠ Y280), V405 (≠ I398), L430 (≠ F423), G431 (= G424), M433 (≠ T426), D458 (= D451), N485 (= N478), E487 (≠ A480), Q488 (≠ W481), M490 (≠ A483), V491 (≠ E484), W494 (≠ N487), L516 (≠ I509), G521 (= G514), L522 (≠ A515)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ A102), P108 (≠ G103), D287 (vs. gap), R288 (vs. gap), M490 (≠ A483), W494 (≠ N487)
- binding flavin-adenine dinucleotide: R157 (= R152), G215 (= G209), A216 (≠ R210), G217 (= G211), N220 (≠ D214), T242 (= T235), L243 (≠ Y236), Q244 (≠ L237), M259 (≠ P252), L260 (≠ I253), M262 (≠ Y255), H263 (≠ M256), G282 (= G275), A283 (≠ T276), R284 (= R277), D286 (≠ S279), R288 (vs. gap), V289 (≠ Y280), E315 (≠ D302), V316 (≠ I303), N320 (≠ H307), G333 (≠ A320), D334 (= D321), A335 (= A322), Q409 (≠ S402), M410 (≠ S403), G428 (≠ L421), G429 (≠ T422)
- binding magnesium ion: D458 (= D451), N485 (= N478), E487 (≠ A480)
Sites not aligning to the query:
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
26% identity, 94% coverage: 4:547/580 of query aligns to 9:556/597 of 1t9aA
- active site: Y30 (≠ I25), G32 (= G27), G33 (≠ S28), A34 (= A29), I35 (≠ F30), E56 (= E50), T79 (≠ Q73), F118 (= F112), Q119 (= Q113), E120 (= E114), K168 (≠ R161), R228 (≠ E219), M264 (≠ Y255), V291 (≠ Y280), V407 (≠ I398), L432 (≠ F423), G433 (= G424), M435 (≠ T426), D460 (= D451), N487 (= N478), E489 (≠ A480), Q490 (≠ W481), M492 (≠ A483), V493 (≠ E484), W496 (≠ N487), L518 (≠ I509), G523 (= G514), L524 (≠ A515)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (≠ S28), V108 (≠ A102), P109 (≠ G103), F118 (= F112), K168 (≠ R161), M264 (≠ Y255), D289 (vs. gap), R290 (vs. gap), M492 (≠ A483), V493 (≠ E484), W496 (≠ N487)
- binding flavin-adenine dinucleotide: R158 (= R152), G217 (= G209), A218 (≠ R210), G219 (= G211), N222 (≠ D214), T244 (= T235), L245 (≠ Y236), Q246 (≠ L237), L262 (≠ I253), M264 (≠ Y255), H265 (≠ M256), G284 (= G275), A285 (≠ T276), R286 (= R277), D288 (≠ S279), R290 (vs. gap), V291 (≠ Y280), E317 (≠ D302), V318 (≠ I303), N322 (≠ H307), G335 (≠ A320), D336 (= D321), A337 (= A322), Q411 (≠ S402), M412 (≠ S403), G430 (≠ L421), G431 (≠ T422)
- binding magnesium ion: D460 (= D451), N487 (= N478), E489 (≠ A480)
- binding propyl trihydrogen diphosphate: V407 (≠ I398), G408 (= G399), Q409 (≠ N400), H410 (≠ T401), M435 (≠ T426), G459 (= G450), D460 (= D451), A461 (≠ G452), S462 (≠ A453), N487 (= N478), E489 (≠ A480), Q490 (≠ W481), G491 (≠ C482), M492 (≠ A483)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G424), M435 (≠ T426), M465 (= M456)
Sites not aligning to the query:
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
26% identity, 94% coverage: 4:547/580 of query aligns to 8:555/596 of 1t9dA
- active site: Y29 (≠ I25), G31 (= G27), G32 (≠ S28), A33 (= A29), I34 (≠ F30), E55 (= E50), T78 (≠ Q73), F117 (= F112), Q118 (= Q113), E119 (= E114), K167 (≠ R161), R227 (≠ E219), M263 (≠ Y255), V290 (≠ Y280), V406 (≠ I398), L431 (≠ F423), G432 (= G424), M434 (≠ T426), D459 (= D451), N486 (= N478), E488 (≠ A480), Q489 (≠ W481), M491 (≠ A483), V492 (≠ E484), W495 (≠ N487), L517 (≠ I509), G522 (= G514), L523 (≠ A515)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ S28), A33 (= A29), V107 (≠ A102), P108 (≠ G103), F117 (= F112), K167 (≠ R161), M263 (≠ Y255), D288 (vs. gap), R289 (vs. gap), W495 (≠ N487)
- binding flavin-adenine dinucleotide: R157 (= R152), G216 (= G209), A217 (≠ R210), G218 (= G211), N221 (≠ D214), T243 (= T235), L244 (≠ Y236), Q245 (≠ L237), M260 (≠ P252), L261 (≠ I253), H264 (≠ M256), G283 (= G275), A284 (≠ T276), R285 (= R277), D287 (≠ S279), R289 (vs. gap), V290 (≠ Y280), E316 (≠ D302), V317 (≠ I303), N321 (≠ H307), G334 (≠ A320), D335 (= D321), A336 (= A322), Q410 (≠ S402), M411 (≠ S403), G429 (≠ L421), G430 (≠ T422)
- binding magnesium ion: D459 (= D451), N486 (= N478), E488 (≠ A480)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E50), P81 (= P76), Q118 (= Q113), G432 (= G424), M434 (≠ T426), M464 (= M456)
Sites not aligning to the query:
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
26% identity, 94% coverage: 4:547/580 of query aligns to 7:541/582 of 1t9dB
- active site: Y28 (≠ I25), G30 (= G27), G31 (≠ S28), A32 (= A29), I33 (≠ F30), E54 (= E50), T77 (≠ Q73), F116 (= F112), Q117 (= Q113), E118 (= E114), K166 (≠ R161), R213 (≠ E219), M249 (≠ Y255), V276 (≠ Y280), V392 (≠ I398), L417 (≠ F423), G418 (= G424), M420 (≠ T426), D445 (= D451), N472 (= N478), E474 (≠ A480), Q475 (≠ W481), M477 (≠ A483), V478 (≠ E484), W481 (≠ N487), L503 (≠ I509), G508 (= G514), L509 (≠ A515)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (≠ S28), A32 (= A29), V106 (≠ A102), P107 (≠ G103), F116 (= F112), K166 (≠ R161), M249 (≠ Y255), D274 (vs. gap), R275 (vs. gap), W481 (≠ N487)
- binding flavin-adenine dinucleotide: R156 (= R152), G202 (= G209), A203 (≠ R210), G204 (= G211), N207 (≠ D214), T229 (= T235), L230 (≠ Y236), Q231 (≠ L237), L247 (≠ I253), M249 (≠ Y255), H250 (≠ M256), G269 (= G275), A270 (≠ T276), R271 (= R277), D273 (≠ S279), R275 (vs. gap), V276 (≠ Y280), E302 (≠ D302), V303 (≠ I303), N307 (≠ H307), G320 (≠ A320), D321 (= D321), A322 (= A322), Q396 (≠ S402), M397 (≠ S403), G415 (≠ L421), G416 (≠ T422)
- binding magnesium ion: D445 (= D451), N472 (= N478), E474 (≠ A480)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E50), P80 (= P76), G418 (= G424), M420 (≠ T426), M450 (= M456)
Sites not aligning to the query:
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 94% coverage: 4:547/580 of query aligns to 92:646/687 of P07342
- R241 (= R152) binding
- 355:376 (vs. 256:277, 45% identical) binding
- 407:426 (vs. 302:321, 20% identical) binding
1y9dD Pyruvate oxidase variant v265a from lactobacillus plantarum (see paper)
27% identity, 94% coverage: 9:553/580 of query aligns to 8:518/560 of 1y9dD
- active site: I24 (= I25), G26 (= G27), G27 (≠ S28), S28 (≠ A29), I29 (≠ F30), E51 (= E50), S74 (≠ Q73), E108 (= E114), V155 (≠ R161), R241 (≠ Y255), V361 (≠ I398), A387 (≠ G424), M389 (≠ T426), D414 (= D451), N441 (= N478), Q443 (≠ A480), Y444 (≠ W481), F446 (≠ A483), I447 (≠ E484), E450 (≠ N487), G513 (= G548)
- binding flavin-adenine dinucleotide: I198 (≠ R210), G199 (= G211), T221 (= T235), P223 (≠ L237), G261 (= G275), N262 (≠ T276), N263 (≠ R277), D273 (= D302), I274 (= I303), K278 (≠ H307), D292 (= D321), A293 (= A322)
- binding magnesium ion: D414 (= D451), N441 (= N478), Q443 (≠ A480)
- binding thiamine diphosphate: E51 (= E50), S74 (≠ Q73), P77 (= P76), H81 (≠ N80), D363 (≠ N400), M389 (≠ T426), G413 (= G450), G415 (= G452), N441 (= N478), Q443 (≠ A480), Y444 (≠ W481), G445 (≠ C482), F446 (≠ A483), I447 (≠ E484)
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
26% identity, 94% coverage: 4:547/580 of query aligns to 8:542/583 of 1t9bA
- active site: Y29 (≠ I25), G31 (= G27), G32 (≠ S28), A33 (= A29), I34 (≠ F30), E55 (= E50), T78 (≠ Q73), F117 (= F112), Q118 (= Q113), E119 (= E114), K167 (≠ R161), R214 (≠ E219), M250 (≠ Y255), V277 (≠ Y280), V393 (≠ I398), L418 (≠ F423), G419 (= G424), M421 (≠ T426), D446 (= D451), N473 (= N478), E475 (≠ A480), Q476 (≠ W481), M478 (≠ A483), V479 (≠ E484), W482 (≠ N487), L504 (≠ I509), G509 (= G514), L510 (≠ A515)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ A102), P108 (≠ G103), F117 (= F112), D275 (vs. gap), R276 (vs. gap), M478 (≠ A483), W482 (≠ N487)
- binding flavin-adenine dinucleotide: R157 (= R152), G203 (= G209), A204 (≠ R210), G205 (= G211), N208 (≠ D214), T230 (= T235), L231 (≠ Y236), Q232 (≠ L237), M247 (≠ P252), L248 (≠ I253), M250 (≠ Y255), H251 (≠ M256), G270 (= G275), A271 (≠ T276), R272 (= R277), D274 (≠ S279), R276 (vs. gap), V277 (≠ Y280), E303 (≠ D302), V304 (≠ I303), N308 (≠ H307), D322 (= D321), A323 (= A322), Q397 (≠ S402), M398 (≠ S403), G416 (≠ L421), G417 (≠ T422)
- binding magnesium ion: D446 (= D451), N473 (= N478), E475 (≠ A480)
Sites not aligning to the query:
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
27% identity, 94% coverage: 4:547/580 of query aligns to 12:556/597 of 6demA
- active site: Y33 (≠ I25), G35 (= G27), G36 (≠ S28), A37 (= A29), I38 (≠ F30), E59 (= E50), T82 (≠ Q73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (≠ R161), K228 (≠ E219), M264 (≠ Y255), V291 (≠ P285), V407 (≠ I398), L432 (≠ F423), G433 (= G424), M435 (≠ T426), D460 (= D451), N487 (= N478), E489 (≠ A480), Q490 (≠ W481), M492 (≠ A483), V493 (≠ E484), W496 (≠ N487), L518 (≠ I509), N523 (≠ G514), V524 (≠ A515)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (≠ Y255), D289 (≠ T283), R290 (≠ L284), M492 (≠ A483), W496 (≠ N487)
- binding flavin-adenine dinucleotide: R161 (= R152), G217 (= G209), A218 (≠ R210), G219 (= G211), N222 (≠ D214), T244 (= T235), L245 (≠ Y236), Q246 (≠ L237), L262 (≠ I253), G284 (= G275), A285 (≠ T276), R286 (= R277), D288 (≠ G282), R290 (≠ L284), V291 (≠ P285), E317 (≠ D302), I318 (= I303), N322 (≠ H307), D336 (= D321), V337 (≠ A322), M412 (≠ S403), G430 (≠ L421)
- binding magnesium ion: D460 (= D451), N487 (= N478), E489 (≠ A480)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ I398), G408 (= G399), Q409 (≠ N400), H410 (≠ T401), M435 (≠ T426), G459 (= G450), D460 (= D451), A461 (≠ G452), S462 (≠ A453), M465 (= M456), N487 (= N478), E489 (≠ A480), Q490 (≠ W481), G491 (≠ C482), M492 (≠ A483), V493 (≠ E484)
Sites not aligning to the query:
Query Sequence
>8501200 FitnessBrowser__Miya:8501200
MPKMTPSEAMAEVLVQEGVTHVSGILGSAFMDLLDLFPAAGIDFISVRHEQTAGHMEDAF
TRMTGRAGVCIGQNGPGITNYVTAVATANMAHTPMVVLSPSAGSISVGWDGFQECDTWNL
FKPITKASLRVPHPKRAADILRTAFRIAYAERGPVLVDIPRDYFYGELDEDILAPSQYRV
APGGIGNPEQFREAVEVLKAAKRPVIVSGRGVVDSGALETVKALAEHLNAPVACTYLHND
AFPCDHPLWTGPIGYMGSKAAMRILQQADVILAVGTRLSYFGTLPQYDINYFPKTAKIVQ
IDINPRHIAKTHPVAVGLCADAKDAAVELLARVREAMPNPRRDDAVYAMVKAELEDWYKE
IAAIADEPVMEGRMHPRKALDVVGRFVTEHNAIATTDIGNTSSTANSYLRFRNAKRSVAT
LTFGNTGFAYQAGLGAQLACPEDTVVAIVGDGAWGMSLFEVPTAVQYNLPVIATVYNNGA
WCAEKKNQVDFYNNRFVGADIWSNSYAAIAEAMGATGYKVNTQADLADALDAARKSRKPS
VIEIMTDGTRLAPPFRRDALALPTRHLPKYDHLDKRHFVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory