SitesBLAST
Comparing 8501222 FitnessBrowser__Miya:8501222 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
1aorA Structure of a hyperthermophilic tungstopterin enzyme, aldehyde ferredoxin oxidoreductase (see paper)
36% identity, 96% coverage: 3:556/575 of query aligns to 7:561/605 of 1aorA
- binding fe (iii) ion: E332 (≠ Y340), H383 (≠ L377)
- binding tungstopterin cofactor: R76 (= R70), A92 (≠ S86), N93 (= N87), G95 (= G89), R182 (= R182), A183 (≠ S183), G185 (= G185), R186 (= R186), E311 (= E319), E313 (= E321), D338 (= D346), D343 (= D351), T344 (≠ S352), R444 (≠ M437), H448 (= H441), I449 (≠ T442), K450 (≠ A443), D489 (= D481), C494 (= C486), L495 (= L487), F496 (= F488)
- binding iron/sulfur cluster: R76 (= R70), C288 (≠ T291), C291 (= C294), I293 (≠ A296), C295 (= C298), C494 (= C486), F496 (= F488)
8c0zB Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
34% identity, 95% coverage: 3:548/575 of query aligns to 6:566/616 of 8c0zB
- binding magnesium ion: N92 (= N87), A182 (≠ S183)
- binding iron/sulfur cluster: R75 (= R70), C295 (≠ H295), C298 (= C298), C302 (= C302), C509 (= C486)
- binding tungsten cofactor: R75 (= R70), S91 (= S86), N92 (= N87), G94 (= G89), R181 (= R182), A182 (≠ S183), A183 (= A184), G184 (= G185), E329 (= E319), E331 (= E321), N356 (≠ D346), P362 (≠ S352), L465 (≠ T442), D504 (= D481), V510 (≠ L487), F511 (= F488)
8c0zA Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
34% identity, 95% coverage: 3:548/575 of query aligns to 6:566/616 of 8c0zA
- binding iron/sulfur cluster: R181 (= R182), C295 (≠ H295), C298 (= C298), C302 (= C302), C509 (= C486)
- binding tungsten cofactor: R75 (= R70), N92 (= N87), G94 (= G89), R181 (= R182), A183 (= A184), G184 (= G185), R185 (= R186), E329 (= E319), E331 (= E321), N356 (≠ D346), P362 (≠ S352), L465 (≠ T442), D504 (= D481), V510 (≠ L487), F511 (= F488)
1b4nA Formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus, complexed with glutarate (see paper)
31% identity, 82% coverage: 3:471/575 of query aligns to 7:471/611 of 1b4nA
- binding calcium ion: G179 (= G179), E304 (≠ G317), D306 (≠ E319)
- binding glutaric acid: Y307 (= Y320), E308 (= E321), Y416 (= Y420), H437 (= H441)
- binding tungstopterin cofactor: K75 (≠ R70), G91 (≠ S86), N92 (= N87), L93 (≠ S88), G94 (= G89), R180 (= R182), A181 (≠ S183), A182 (= A184), G183 (= G185), R184 (= R186), D306 (≠ E319), E308 (= E321), N309 (≠ T322), D333 (= D346), M337 (≠ I350), D338 (= D351), T339 (≠ S352), H436 (≠ D440), H437 (= H441), K438 (≠ T442)
- binding iron/sulfur cluster: K75 (≠ R70), G283 (= G293), C284 (= C294), C287 (= C298), M289 (≠ I300), C291 (= C302)
Sites not aligning to the query:
1b25A Formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus (see paper)
31% identity, 82% coverage: 3:471/575 of query aligns to 7:471/611 of 1b25A
- binding tungstopterin: K75 (≠ R70), G91 (≠ S86), N92 (= N87), L93 (≠ S88), G94 (= G89), G179 (= G179), R180 (= R182), A181 (≠ S183), G183 (= G185), R184 (= R186), T240 (= T245), E304 (≠ G317), D306 (≠ E319), Y307 (= Y320), E308 (= E321), N309 (≠ T322), D333 (= D346), D338 (= D351), T339 (≠ S352), I340 (= I353), H436 (≠ D440), H437 (= H441), K438 (≠ T442)
- binding iron/sulfur cluster: K75 (≠ R70), R180 (= R182), C284 (= C294), C287 (= C298), M289 (≠ I300), C291 (= C302)
Sites not aligning to the query:
4z3yA Active site complex bambc of benzoyl coenzyme a reductase in complex with benzoyl-coa (see paper)
33% identity, 34% coverage: 26:219/575 of query aligns to 33:217/653 of 4z3yA
Sites not aligning to the query:
- binding benzoyl coenzyme A: 249, 259, 323, 436, 439, 440, 445, 458, 461, 466, 500, 504
- binding iron/sulfur cluster: 299, 302, 304, 305, 306, 534
4z3wC Active site complex bambc of benzoyl coenzyme a reductase in complex with 1,5 dienoyl-coa (see paper)
33% identity, 34% coverage: 26:219/575 of query aligns to 33:217/653 of 4z3wC
Sites not aligning to the query:
- binding 1,5 Dienoyl-CoA: 249, 259, 260, 323, 436, 438, 439, 440, 445, 458, 461, 466, 499, 500, 504
- binding iron/sulfur cluster: 299, 302, 304, 306, 534
4z3zA Active site complex bambc of benzoyl coenzyme a reductase in complex with zinc (see paper)
33% identity, 34% coverage: 26:219/575 of query aligns to 33:217/652 of 4z3zA
Sites not aligning to the query:
6x1oC Wor5 from pyrococcus furiosus, as crystallized (see paper)
25% identity, 85% coverage: 28:516/575 of query aligns to 34:519/624 of 6x1oC
- binding magnesium ion: M194 (≠ I181), D323 (≠ S316), D326 (≠ E319)
- binding phosphate ion: R249 (≠ P234), Y296 (≠ H292)
- binding tungstopterin cofactor: K77 (≠ R70), S93 (≠ G90), V94 (≠ S91), L95 (≠ F92), S96 (= S93), H195 (≠ R182), A196 (≠ S183), A197 (= A184), G198 (= G185), Y199 (≠ R186), D326 (≠ E319), E328 (= E321), D353 (= D346), D358 (= D351), G359 (≠ S352), I360 (= I353), H469 (= H441), T470 (= T442), Y489 (≠ V480), D490 (= D481), I494 (≠ M485), C495 (= C486), N496 (≠ L487), F497 (= F488)
- binding iron/sulfur cluster: S96 (= S93), D299 (≠ H295), C302 (= C298), C306 (= C302), C495 (= C486), F497 (= F488), V498 (≠ I489)
- binding (1R)-1-hydroxybutane-1-sulfonic acid: T253 (≠ Q238), Y327 (= Y320), E328 (= E321), H446 (≠ Y420), H469 (= H441)
Query Sequence
>8501222 FitnessBrowser__Miya:8501222
MAKFIRIDMGSRTAEIGACPEKYAGLAGRGLTSMFIADEVKPTCHPLGKYNKLVFAPGFL
TGTSAVNSGRISCGAKSPLTGGIKESNSGGSFSQKMARLDIKALVFEGLPADGKYAVVKV
DKDGVTFDEAPAEIMGAGNYDAIRVLQDKYGPKVGVALIGPAGEMKLTAANISFADPEGN
IRSAGRGGLGAVMGSKGIKAVVIDDAGAPAVPIAKPEEFKSAAKRFANALTTHPVTGQGL
PKYGTNVLVNILNEAGGLPTENFRRGRNEWANNIGGETMAATIEERGGKTTHGCHAGCVI
RCSQHYVDKQGKYITSGFEYETIWALGADAAIDDLDAIAYADREFDEVGIDSIETSVAVA
VAMDAGVIPWGDGKAALDLIKQIRQGTPLGRILGSGAAAVGQMYGLTRVPVVKNQAIPAY
DPRAVKGVGLTYATTPMGADHTAGYAVATNILRVGGFVDPLGKEGQVELSRNLQIATAAV
DSTGMCLFIAFAILDIPDGFNALVDMINARYDLSLTGDDVTALGKTILKAELDFNRRAGF
TSAHDRLPEFFEEPCPPHNTVWDFTDEEIDSVLAF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory