SitesBLAST
Comparing 8501323 FitnessBrowser__Miya:8501323 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
6n2oD 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
31% identity, 81% coverage: 21:234/263 of query aligns to 15:217/291 of 6n2oD
- binding magnesium ion: D101 (= D106), N129 (= N134), I131 (≠ V136)
- binding succinyl-coenzyme a: I57 (= I62), R62 (≠ F67), L134 (≠ M139), K136 (≠ G141)
- binding iron/sulfur cluster: W24 (≠ Y30), C25 (= C31), C28 (= C34), C59 (= C64), C208 (= C225), T210 (= T227), F211 (≠ N228)
- binding thiamine diphosphate: I57 (= I62), G58 (= G63), C59 (= C64), S60 (= S65), H76 (= H81), G102 (= G107), D103 (= D108), N129 (= N134), I131 (≠ V136), G133 (= G138), L134 (≠ M139), T135 (= T140)
6n2oB 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
31% identity, 81% coverage: 21:234/263 of query aligns to 15:217/291 of 6n2oB
- binding 2-oxoglutaric acid: R62 (≠ F67), L134 (≠ M139)
- binding coenzyme a: K136 (≠ G141), Y150 (≠ T155)
- binding magnesium ion: D101 (= D106), N129 (= N134), I131 (≠ V136)
- binding iron/sulfur cluster: W24 (≠ Y30), C25 (= C31), C28 (= C34), C59 (= C64), C208 (= C225), T210 (= T227), F211 (≠ N228)
- binding thiamine diphosphate: I57 (= I62), G58 (= G63), C59 (= C64), S60 (= S65), H76 (= H81), G102 (= G107), D103 (= D108), N129 (= N134), I131 (≠ V136), Y132 (= Y137), G133 (= G138), L134 (≠ M139), T135 (= T140)
6n2nB Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
31% identity, 81% coverage: 21:234/263 of query aligns to 15:217/291 of 6n2nB
- binding magnesium ion: D101 (= D106), N129 (= N134), I131 (≠ V136)
- binding iron/sulfur cluster: W24 (≠ Y30), C25 (= C31), C28 (= C34), H30 (= H36), C59 (= C64), C208 (= C225), T210 (= T227), F211 (≠ N228)
- binding thiamine diphosphate: I57 (= I62), G58 (= G63), C59 (= C64), S60 (= S65), H76 (= H81), G100 (= G105), D101 (= D106), G102 (= G107), D103 (= D108), N129 (= N134), I131 (≠ V136), Y132 (= Y137), G133 (= G138), L134 (≠ M139), T135 (= T140)
Q96XT4 2-oxoacid:ferredoxin oxidoreductase 2, subunit beta; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
31% identity, 75% coverage: 30:227/263 of query aligns to 11:199/304 of Q96XT4
5b46B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
31% identity, 75% coverage: 30:227/263 of query aligns to 8:196/301 of 5b46B
- binding magnesium ion: D87 (= D106), N115 (= N134), V117 (= V136)
- binding iron/sulfur cluster: W8 (≠ Y30), C9 (= C31), C12 (= C34), C43 (= C64), C194 (= C225), T196 (= T227)
- binding thiamine diphosphate: I41 (= I62), G42 (= G63), C43 (= C64), S44 (= S65), H62 (= H81), G86 (= G105), G88 (= G107), D89 (= D108), N115 (= N134), V117 (= V136), Y118 (= Y137), G119 (= G138), L120 (≠ M139), T121 (= T140)
Sites not aligning to the query:
Q96Y68 2-oxoacid:ferredoxin oxidoreductase 1, subunit beta; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 2 papers)
31% identity, 75% coverage: 30:227/263 of query aligns to 11:199/305 of Q96Y68
- C12 (= C31) binding
- C15 (= C34) binding
- C46 (= C64) binding
- K49 (≠ F67) mutation to I: Loss of oxidoreductase activity toward 2-oxoglutarate but retains its activity toward pyruvate.
- D90 (= D106) binding
- GD 91:92 (= GD 107:108) binding
- N118 (= N134) binding
- V120 (= V136) binding
- GL 122:123 (≠ GM 138:139) binding
- K125 (≠ G141) Plays an important role in the binding of CoA; mutation to A: Shows a strong decrease of affinity for CoA and a poor inactivation by 4-fluoro-7-nitrobenzofurazan (NBD-F).
- K173 (= K194) mutation to A: Same oxidoreductase activity as the wild-type.
- C197 (= C225) binding
P72579 2-oxoacid:ferredoxin oxidoreductase subunit beta; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see paper)
31% identity, 75% coverage: 30:227/263 of query aligns to 11:199/305 of P72579
- K49 (≠ F67) mutation to I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to R: Increase the oxidoreductase activity with pyruvate.; mutation to V: Slight decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.
- L123 (≠ M139) mutation L->A,I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to N: Strong decrease of the oxidoreductase activity with pyruvate and 2-oxobutyrate. However, this mutant shows almost the same activity with 2-oxoglutarate as the wild-type.
5b48B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
30% identity, 77% coverage: 30:231/263 of query aligns to 7:196/286 of 5b48B
- binding magnesium ion: D84 (= D106), N112 (= N134), V114 (= V136)
- binding iron/sulfur cluster: C8 (= C31), C11 (= C34), C42 (= C64), C183 (= C225), T185 (= T227)
- binding 2-[(2E)-3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-(1-oxidanylpropylidene)-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: I40 (= I62), G41 (= G63), C42 (= C64), S43 (= S65), H59 (= H81), G85 (= G107), D86 (= D108), N112 (= N134), V114 (= V136), Y115 (= Y137), G116 (= G138), L117 (≠ M139)
5b47B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
27% identity, 89% coverage: 30:262/263 of query aligns to 4:221/275 of 5b47B
- binding magnesium ion: D83 (= D106), N111 (= N134)
- binding iron/sulfur cluster: C5 (= C31), C8 (= C34), C39 (= C64), C179 (= C225)
- binding thiamine diphosphate: I37 (= I62), G38 (= G63), C39 (= C64), S40 (= S65), H58 (= H81), G84 (= G107), D85 (= D108), N111 (= N134), V113 (= V136), Y114 (= Y137), L116 (≠ M139)
5exdF Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
26% identity, 78% coverage: 31:235/263 of query aligns to 24:235/310 of 5exdF
- active site: N143 (≠ M139)
- binding magnesium ion: D110 (= D106), N138 (= N134), S140 (≠ V136)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-[1,1,2-tris(oxidanyl)-2-oxidanylidene-ethyl]-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: T50 (≠ I62), G51 (= G63), C52 (= C64), I74 (vs. gap), D110 (= D106), G111 (= G107), Y136 (≠ V132), N138 (= N134), S140 (≠ V136), Y141 (= Y137), A142 (≠ G138), N143 (≠ M139), T144 (= T140)
- binding iron/sulfur cluster: C24 (= C31), C27 (= C34), P29 (≠ H36), C52 (= C64), A142 (≠ G138), C225 (= C225), K227 (≠ T227)
5c4iC Structure of an oxalate oxidoreductase (see paper)
26% identity, 78% coverage: 31:235/263 of query aligns to 24:235/312 of 5c4iC
- active site: N143 (≠ M139)
- binding magnesium ion: D110 (= D106), N138 (= N134), S140 (≠ V136)
- binding iron/sulfur cluster: C24 (= C31), C27 (= C34), P29 (≠ H36), C52 (= C64), A142 (≠ G138), C225 (= C225), P226 (= P226), K227 (≠ T227)
- binding thiamine diphosphate: T50 (≠ I62), G51 (= G63), C52 (= C64), I74 (vs. gap), G109 (= G105), D110 (= D106), G111 (= G107), Y136 (≠ V132), N138 (= N134), S140 (≠ V136), Y141 (= Y137), A142 (≠ G138), N143 (≠ M139), T144 (= T140)
5exeC Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
26% identity, 78% coverage: 31:235/263 of query aligns to 24:235/314 of 5exeC
- active site: N143 (≠ M139)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-carboxy-4-methyl-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: T50 (≠ I62), G51 (= G63), C52 (= C64), I74 (vs. gap), G109 (= G105), D110 (= D106), G111 (= G107), Y136 (≠ V132), N138 (= N134), S140 (≠ V136), Y141 (= Y137), A142 (≠ G138), N143 (≠ M139), T144 (= T140)
- binding magnesium ion: D110 (= D106), D130 (≠ R126), N138 (= N134), S140 (≠ V136), L211 (≠ F207), Q213 (≠ V209)
- binding iron/sulfur cluster: C24 (= C31), C27 (= C34), P29 (≠ H36), C52 (= C64), C225 (= C225), P226 (= P226), K227 (≠ T227)
Query Sequence
>8501323 FitnessBrowser__Miya:8501323
MQADERLALADDEQMAFEVPDVLVDRATHYCPGCHHGIAHRLVAEVLEEMGVVDDTICVA
SIGCSVFIYNYLAVDSVEAPHGRAPAVATGVKRGRTDKIVFTYQGDGDLASIGLAEVMHA
ANRGERITIVFVNNTVYGMTGGQMAPTTLIGQKTTTCPGGRCRDREGMPIRMAEIIAGLG
GVAYSARASLDSVKNIRAAKKAVRKAFDVQQQGLGFGFVELLSGCPTNWRMDAVKANTRI
REEMIPYFPLGVYKDVTEGEGVC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory