Comparing 8501342 FitnessBrowser__Miya:8501342 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fuqA Fumarase with bound 3-trimethylsilylsuccinic acid (see paper)
59% identity, 90% coverage: 44:519/528 of query aligns to 2:456/456 of 1fuqA
1fuoA FumarasE C with bound citrate (see paper)
59% identity, 90% coverage: 44:519/528 of query aligns to 2:456/456 of 1fuoA
P05042 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Escherichia coli (strain K12) (see 4 papers)
59% identity, 90% coverage: 44:519/528 of query aligns to 5:459/467 of P05042
1fupA Fumarase with bound pyromellitic acid (see paper)
59% identity, 90% coverage: 44:519/528 of query aligns to 1:455/455 of 1fupA
P07954 Fumarate hydratase, mitochondrial; Fumarase; HsFH; EC 4.2.1.2 from Homo sapiens (Human) (see 4 papers)
54% identity, 93% coverage: 32:522/528 of query aligns to 39:509/510 of P07954
Sites not aligning to the query:
7lubB Crystal structure of recombinant human fumarase in complex with d-2- amino-3-phosphono-propionic acid (see paper)
55% identity, 91% coverage: 44:522/528 of query aligns to 3:461/462 of 7lubB
Q9ZCQ4 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Rickettsia prowazekii (strain Madrid E) (see paper)
51% identity, 91% coverage: 42:519/528 of query aligns to 3:459/461 of Q9ZCQ4
P08417 Fumarate hydratase, mitochondrial; Fumarase; EC 4.2.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
52% identity, 91% coverage: 44:522/528 of query aligns to 29:487/488 of P08417
Sites not aligning to the query:
7c18B Crystal structure of fumarasec from mannheimia succiniciproducens in complex with fumarate
51% identity, 90% coverage: 44:519/528 of query aligns to 4:459/464 of 7c18B
P9WN93 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
46% identity, 91% coverage: 43:524/528 of query aligns to 10:468/474 of P9WN93
4adlA Crystal structures of rv1098c in complex with malate (see paper)
46% identity, 91% coverage: 43:521/528 of query aligns to 2:457/459 of 4adlA
4apbD Crystal structure of mycobacterium tuberculosis fumarase (rv1098c) s318c in complex with fumarate (see paper)
46% identity, 91% coverage: 43:524/528 of query aligns to 2:460/462 of 4apbD
6s88A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-((1,2,4,5-tetrahydro- 3h-benzo[d]azepin-3-yl)sulfonyl)phenyl)-2-(4-oxo-3,4- dihydrophthalazin-1-yl)acetamide (see paper)
45% identity, 91% coverage: 43:521/528 of query aligns to 1:448/450 of 6s88A
6s7wA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(quinolin-4-yl)acetamide (see paper)
45% identity, 91% coverage: 43:521/528 of query aligns to 1:448/450 of 6s7wA
6s7sA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-(n-phenylsulfamoyl) phenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
45% identity, 91% coverage: 43:521/528 of query aligns to 1:448/450 of 6s7sA
6s7uA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(1h-indol-3-yl)acetamide (see paper)
44% identity, 91% coverage: 43:521/528 of query aligns to 1:448/450 of 6s7uA
6s7kA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-(n-methylsulfamoyl) phenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
44% identity, 91% coverage: 43:521/528 of query aligns to 1:448/450 of 6s7kA
6s43A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azocan-1-ylsulfonyl)-2- methoxyphenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
44% identity, 91% coverage: 43:521/528 of query aligns to 1:448/450 of 6s43A
6s7zA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-((3,4-dihydroisoquinolin-2(1h)- yl)sulfonyl)-2-methoxyphenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl) acetamide (see paper)
44% identity, 91% coverage: 43:521/528 of query aligns to 1:447/449 of 6s7zA
5f91A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator (n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide) (see paper)
44% identity, 91% coverage: 43:521/528 of query aligns to 2:445/447 of 5f91A
>8501342 FitnessBrowser__Miya:8501342
MPQTPDQPHLPRTPHQADMPHQANGPHRPEQPTDAQPAARPGHRLERDSMGLVEVEQGRL
WGAQTQRSLDNFRIGTDRMPLAVVHALARIKKAAALVNRDLGLLPPPPPGQPDQPGLPHM
AEAIARAADEVLAGQHDDHFPLSVWQTGSGTQTNMNVNEVLANRATQLLAEAAHAAASGG
HPHIHPPIHPNDHVNRCQSSNDAFPAAMHLAAALALRDDLLPGVRHLRDALRAKAAACAD
IVKIGRTHLQDAVPLTLGDEMSGWAAQLDACLEGLDAAMPHLCRLALGGTAVGTGLNAHP
AFAPRAIALLADMTGLPLVPAPNPFAALAAHDGLVLTSGALRALATALLKIANDVRWLAS
GPRCGIGELRLPENEPGSSIMPGKVNPTQCEALTMVAVQVMGLDVAVGMAGSQGNFELNV
FKPLIIHNVLTSMRLLADGCRSFADHAVAGMQPDRAGIAAHVGRSLMLVTALAPVVGYDR
AAQAAHRAHAQGITLREACLEMQLLDGAAFDAAVDPLRMARPHEGHEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory