Comparing 8501343 FitnessBrowser__Miya:8501343 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5ys3A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri (see paper)
68% identity, 98% coverage: 4:182/183 of query aligns to 1:179/188 of 5ys3A
P0AC98 Succinate-acetate/proton symporter SatP; Succinate-acetate transporter protein from Escherichia coli (strain K12) (see paper)
67% identity, 99% coverage: 2:182/183 of query aligns to 3:183/188 of P0AC98
5ys8A 2.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri (see paper)
68% identity, 97% coverage: 5:182/183 of query aligns to 1:178/182 of 5ys8A
P41943 Glyoxylate pathway regulator from Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) (see paper)
35% identity, 86% coverage: 2:158/183 of query aligns to 74:236/270 of P41943
Sites not aligning to the query:
>8501343 FitnessBrowser__Miya:8501343
METKLANPAPLGLMGFGMTTILLNIHNAGFFPISSMILAMGIFYGGIAQVIAGIMEFKKG
NTFGTTAFTSYGLFWLTLVALIVMPKLGWAEPTPHAYMGFYLAMWGLFTFFMFLGTLKGK
TTLKFIFLSLTVLFALLAIRDFTGSELIGTIAGWEGIVCGASACYLAMAEVLHEQYGRVV
LPY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory