SitesBLAST
Comparing 8501344 FitnessBrowser__Miya:8501344 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
41% identity, 52% coverage: 271:586/602 of query aligns to 9:304/313 of 2q7vA
- active site: P41 (≠ V303), I45 (≠ V307), E50 (≠ V312), C141 (= C397), C144 (= C400), D145 (= D401)
- binding flavin-adenine dinucleotide: G16 (= G278), P17 (= P279), A18 (= A280), E37 (≠ D299), K38 (= K300), G43 (= G305), Q44 (= Q306), I45 (≠ V307), N53 (= N315), E85 (≠ T346), V86 (= V347), T118 (= T374), G119 (= G375), C144 (= C400), G282 (= G565), D283 (= D566), Q291 (= Q573), L292 (≠ I574), S295 (≠ A577)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
40% identity, 53% coverage: 271:590/602 of query aligns to 3:298/303 of 5mh4A
- active site: V34 (= V302), P35 (≠ V303), M39 (≠ V307), E44 (≠ V312), C130 (= C397), C133 (= C400), D134 (= D401)
- binding flavin-adenine dinucleotide: G10 (= G278), P11 (= P279), A12 (= A280), E31 (≠ D299), R32 (≠ K300), G37 (= G305), Q38 (= Q306), T42 (= T310), N47 (= N315), G77 (≠ Q337), V79 (≠ A339), T107 (= T374), G108 (= G375), E155 (≠ D422), V239 (≠ N531), F242 (≠ Q534), G272 (= G565), D273 (= D566), Q281 (= Q573), I282 (= I574)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (= I413), G147 (= G414), G148 (= G415), G149 (= G416), D150 (≠ N417), S151 (= S418), E154 (≠ T421), H170 (= H437), R171 (= R438), R172 (= R439), R176 (= R443), V234 (≠ I526), G235 (= G527), R280 (= R572), Q281 (= Q573)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
37% identity, 53% coverage: 271:588/602 of query aligns to 8:301/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G276), G15 (= G278), P16 (= P279), A17 (= A280), E36 (≠ D299), R37 (≠ K300), G42 (= G305), Q43 (= Q306), T47 (= T310), N52 (= N315), G82 (≠ E345), V84 (= V347), A111 (= A373), S112 (≠ T374), G113 (= G375), C138 (= C400), G277 (= G565), D278 (= D566), Q286 (= Q573), I287 (= I574)
- binding alpha-D-glucopyranose: R27 (= R290), D49 (≠ V312), K74 (≠ Q337), F75 (≠ Y338), P122 (= P384), G123 (= G385), E126 (≠ R388), G129 (= G391), G131 (= G393), V132 (= V394), F143 (≠ Y405), E206 (= E467), N208 (≠ E495)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
37% identity, 53% coverage: 271:588/602 of query aligns to 5:298/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G276), G12 (= G278), P13 (= P279), A14 (= A280), E33 (≠ D299), R34 (≠ K300), G39 (= G305), Q40 (= Q306), T44 (= T310), N49 (= N315), G79 (≠ E345), D80 (≠ T346), V81 (= V347), S109 (≠ T374), G110 (= G375), Y113 (≠ W378), C135 (= C400), G274 (= G565), D275 (= D566), Q283 (= Q573), I284 (= I574)
- binding alpha-D-glucopyranose: D46 (≠ V312), E48 (= E314), G126 (= G391), G128 (= G393), D136 (= D401), A138 (≠ F403), F139 (≠ M404), F139 (≠ M404), F140 (≠ Y405)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G415), G151 (= G416), D152 (≠ N417), S153 (= S418), E156 (≠ T421), H172 (= H437), R173 (= R438), R174 (= R439), R178 (= R443), I236 (= I526)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
36% identity, 53% coverage: 271:589/602 of query aligns to 6:300/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G278), P14 (= P279), A15 (= A280), E34 (≠ D299), Q35 (≠ K300), G40 (= G305), Q41 (= Q306), T45 (= T310), N50 (= N315), V82 (= V341), T110 (= T374), G111 (= G375), Y114 (≠ W378), C136 (= C400), V242 (≠ N531), G275 (= G565), D276 (= D566), Q284 (= Q573), I285 (= I574)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 53% coverage: 270:588/602 of query aligns to 7:310/321 of P0A9P4
- 36:43 (vs. 299:306, 38% identical) binding
- C136 (= C397) modified: Disulfide link with 139, Redox-active
- C139 (= C400) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 566:574, 40% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
37% identity, 54% coverage: 266:588/602 of query aligns to 6:312/319 of 5u63B
- active site: C139 (= C397), C142 (= C400), D143 (= D401)
- binding flavin-adenine dinucleotide: G16 (= G276), S17 (≠ A277), G18 (= G278), P19 (= P279), A20 (= A280), T39 (≠ D299), G40 (≠ K300), Q42 (≠ V302), G45 (= G305), Q46 (= Q306), L47 (≠ V307), T50 (= T310), N55 (= N315), H87 (≠ T346), I88 (≠ V347), A115 (= A373), T116 (= T374), G117 (= G375), H248 (= H528), G288 (= G565), D289 (= D566), R296 (= R572), Q297 (= Q573), A298 (≠ I574), S301 (≠ A577)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (= R379), G157 (= G415), H179 (= H437), R180 (= R438), R181 (= R439), I246 (= I526), G247 (= G527), H248 (= H528), R296 (= R572)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
37% identity, 54% coverage: 266:588/602 of query aligns to 5:311/319 of 5vt3B
- active site: C138 (= C397), C141 (= C400), D142 (= D401)
- binding flavin-adenine dinucleotide: G15 (= G276), S16 (≠ A277), G17 (= G278), P18 (= P279), A19 (= A280), T38 (≠ D299), G39 (≠ K300), Q41 (≠ V302), G44 (= G305), Q45 (= Q306), L46 (≠ V307), T49 (= T310), N54 (= N315), H86 (≠ T346), I87 (≠ V347), S114 (≠ A373), T115 (= T374), G116 (= G375), E162 (≠ T421), H247 (= H528), G287 (= G565), D288 (= D566), R295 (= R572), Q296 (= Q573), A297 (≠ I574), S300 (≠ A577)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L381), G156 (= G415), G157 (= G416), N158 (= N417), T159 (≠ S418), H178 (= H437), R179 (= R438), R180 (= R439), R184 (= R443), I245 (= I526), G246 (= G527), R295 (= R572), Q296 (= Q573)
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
37% identity, 53% coverage: 270:588/602 of query aligns to 6:309/320 of 1f6mA
- active site: S135 (≠ C397), C138 (= C400), D139 (= D401)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L381), G153 (= G415), G154 (= G416), N155 (= N417), T156 (≠ S418), E159 (≠ T421), H175 (= H437), R176 (= R438), R177 (= R439), R181 (= R443), I243 (= I526), G244 (= G527), H245 (= H528), R293 (= R572), Q294 (= Q573)
- binding flavin-adenine dinucleotide: G12 (= G276), S13 (≠ A277), G14 (= G278), P15 (= P279), A16 (= A280), T35 (≠ D299), G36 (≠ K300), E38 (≠ V302), G41 (= G305), Q42 (= Q306), L43 (≠ V307), T46 (= T310), V49 (= V313), N51 (= N315), H83 (≠ T346), I84 (≠ V347), A111 (= A373), T112 (= T374), G113 (= G375), H245 (= H528), G285 (= G565), D286 (= D566), R293 (= R572), Q294 (= Q573), A295 (≠ I574), S298 (≠ A577)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
37% identity, 53% coverage: 270:588/602 of query aligns to 6:309/316 of 1tdfA
- active site: C135 (= C397), S138 (≠ C400), D139 (= D401)
- binding flavin-adenine dinucleotide: G12 (= G276), S13 (≠ A277), G14 (= G278), P15 (= P279), A16 (= A280), T35 (≠ D299), G36 (≠ K300), E38 (≠ V302), G41 (= G305), Q42 (= Q306), L43 (≠ V307), T46 (= T310), V49 (= V313), N51 (= N315), H83 (≠ T346), I84 (≠ V347), A111 (= A373), T112 (= T374), S138 (≠ C400), G285 (= G565), D286 (= D566), R293 (= R572), Q294 (= Q573), A295 (≠ I574), S298 (≠ A577)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L381), I151 (= I413), T156 (≠ S418), E159 (≠ T421), H175 (= H437), R176 (= R438), R181 (= R443), E183 (= E445), I243 (= I526), G244 (= G527), H290 (≠ G570), R293 (= R572)
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
37% identity, 53% coverage: 271:592/602 of query aligns to 6:303/305 of 3ctyB
- active site: A38 (≠ V303), T42 (≠ V307), L47 (≠ V312), N50 (= N315), C133 (= C397), C136 (= C400), D137 (= D401)
- binding flavin-adenine dinucleotide: V10 (≠ L275), G11 (= G276), A15 (= A280), D34 (= D299), K35 (= K300), G40 (= G305), L41 (≠ Q306), T42 (≠ V307), A45 (≠ T310), P46 (= P311), N50 (= N315), V82 (= V347), T110 (= T374), G111 (= G375), S154 (= S418), Q241 (≠ N531), G275 (= G565), D276 (= D566), A283 (≠ R572), Q284 (= Q573), I285 (= I574)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
40% identity, 53% coverage: 272:588/602 of query aligns to 9:307/315 of 4jnqA
- active site: C137 (= C397), C140 (= C400), D141 (= D401)
- binding dihydroflavine-adenine dinucleotide: I12 (≠ L275), G13 (= G276), S14 (≠ A277), G15 (= G278), P16 (= P279), A17 (= A280), A36 (≠ D299), G37 (≠ K300), Q39 (≠ V302), G42 (= G305), Q43 (= Q306), L44 (≠ V307), N52 (= N315), I85 (≠ L355), A113 (= A373), T114 (= T374), C140 (= C400), G283 (= G565), D284 (= D566), R291 (= R572), Q292 (= Q573), A293 (≠ I574)
4gcmB Crystal structure of a thioredoxine reductase (trxb) from staphylococcus aureus subsp. Aureus mu50 at 1.80 a resolution
36% identity, 54% coverage: 268:590/602 of query aligns to 3:301/309 of 4gcmB
- active site: C133 (= C397), C136 (= C400), D137 (= D401)
- binding flavin-adenine dinucleotide: G11 (= G276), G13 (= G278), P14 (= P279), A15 (= A280), E34 (≠ D299), R35 (≠ K300), G40 (= G305), Q41 (= Q306), T45 (= T310), N50 (= N315), D81 (≠ T346), I82 (≠ V347), T110 (= T374), G111 (= G375), C136 (= C400), G275 (= G565), D276 (= D566), Q284 (= Q573), I285 (= I574)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I117 (≠ L381), G151 (= G415), G152 (= G416), D153 (≠ N417), S154 (= S418), E157 (≠ T421), R174 (= R438), R175 (= R439), R179 (= R443), Q181 (≠ E445), I237 (= I526)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
33% identity, 53% coverage: 271:589/602 of query aligns to 8:302/308 of 3f8rA
- active site: C133 (= C397), C136 (= C400), D137 (= D401)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (≠ L275), G13 (= G276), L14 (≠ A277), G15 (= G278), P16 (= P279), A17 (= A280), E37 (≠ K300), T38 (≠ S301), G41 (= G305), Q42 (= Q306), I82 (≠ T346), V83 (= V347), G109 (≠ A373), I110 (≠ T374), G111 (= G375), R115 (= R379), L117 (= L381), D153 (≠ N417), S154 (= S418), E157 (≠ T421), R174 (= R438), R175 (= R439), Y184 (≠ L448), I236 (= I526), G275 (= G565), D276 (= D566), L282 (vs. gap), G283 (= G570), R285 (= R572)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
37% identity, 53% coverage: 271:588/602 of query aligns to 16:311/335 of P9WHH1
- SGPA 22:25 (≠ AGPA 277:280) binding
- Y32 (= Y287) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 299:306, 25% identical) binding
- N60 (= N315) binding
- V93 (= V347) binding
- C145 (= C397) modified: Disulfide link with 148, Redox-active
- C148 (= C400) modified: Disulfide link with 145, Redox-active
- S166 (= S418) binding
- H185 (= H437) binding
- R191 (= R443) binding
- I248 (= I526) binding
- Y268 (≠ S547) binding
- D288 (= D566) binding
- R295 (= R572) binding
- RQAV 295:298 (≠ RQIV 572:575) binding
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
38% identity, 52% coverage: 271:584/602 of query aligns to 7:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G276), G14 (= G278), P15 (= P279), A16 (= A280), F34 (≠ L298), E35 (≠ D299), K36 (= K300), G41 (= G305), A42 (≠ Q306), V83 (≠ E349), T112 (= T374), G113 (= G375), G276 (= G565), D277 (= D566)
- binding nicotinamide-adenine-dinucleotide: G153 (= G415), G154 (= G416), S156 (= S418), Q175 (≠ H437), N176 (≠ R438), T181 (≠ R443), V238 (≠ I526)
3f8pD Structure of sulfolobus solfataricus trxr-b3 (see paper)
34% identity, 53% coverage: 271:589/602 of query aligns to 8:304/310 of 3f8pD
- active site: C135 (= C397), C138 (= C400), D139 (= D401)
- binding nicotinamide-adenine-dinucleotide: V12 (≠ L275), G13 (= G276), L14 (≠ A277), G15 (= G278), P16 (= P279), A17 (= A280), G36 (≠ D299), T38 (≠ S301), G41 (= G305), Q42 (= Q306), I82 (≠ T346), V83 (= V347), G111 (≠ A373), I112 (≠ T374), G113 (= G375), G277 (= G565), D278 (= D566)
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
37% identity, 53% coverage: 271:588/602 of query aligns to 7:302/313 of 2a87A
- active site: F39 (≠ V303), L43 (≠ V307), D48 (≠ V312), C136 (= C397), C139 (= C400), D140 (= D401)
- binding flavin-adenine dinucleotide: G12 (= G276), S13 (≠ A277), G14 (= G278), P15 (= P279), A16 (= A280), F34 (≠ L298), E35 (≠ D299), G36 (≠ K300), G40 (= G304), G41 (= G305), A42 (≠ Q306), L43 (≠ V307), T46 (= T310), V49 (= V313), N51 (= N315), D83 (≠ T346), V84 (= V347), M113 (≠ T374), C139 (= C400), G278 (= G565), D279 (= D566), R286 (= R572), Q287 (= Q573), A288 (≠ I574), V289 (= V575)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L381), G155 (= G416), D156 (≠ N417), S157 (= S418), H176 (= H437), R177 (= R438), R178 (= R439), R182 (= R443), I239 (= I526), Y259 (≠ S547), R283 (≠ G569), R286 (= R572)
3f8dA Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a (see paper)
33% identity, 53% coverage: 271:589/602 of query aligns to 8:302/308 of 3f8dA
- active site: C133 (= C397), A136 (≠ C400), D137 (= D401)
- binding flavin-adenine dinucleotide: V12 (≠ L275), G13 (= G276), L14 (≠ A277), G15 (= G278), P16 (= P279), A17 (= A280), G36 (≠ D299), E37 (≠ K300), T38 (≠ S301), G41 (= G305), Q42 (= Q306), E45 (≠ V309), A46 (≠ T310), V49 (= V313), D51 (≠ N315), I82 (≠ T346), V83 (= V347), G109 (≠ A373), I110 (≠ T374), G111 (= G375), C133 (= C397), A136 (≠ C400), G275 (= G565), D276 (= D566), R285 (= R572), Q286 (= Q573), V287 (≠ I574)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
36% identity, 53% coverage: 271:588/602 of query aligns to 5:299/306 of 5uthA
- active site: C133 (= C397), C136 (= C400), D137 (= D401)
- binding flavin-adenine dinucleotide: I9 (≠ L275), G10 (= G276), S11 (≠ A277), G12 (= G278), P13 (= P279), A14 (= A280), F32 (≠ L298), E33 (≠ D299), G34 (≠ K300), Q36 (≠ V302), G39 (= G305), A40 (≠ Q306), L41 (≠ V307), N49 (= N315), D81 (≠ T346), V82 (= V347), M110 (≠ T374), G111 (= G375), C136 (= C400), G275 (= G565), D276 (= D566), R283 (= R572), Q284 (= Q573), A285 (≠ I574), A288 (= A577)
Query Sequence
>8501344 FitnessBrowser__Miya:8501344
MKLSVSNSRGKDAADRDWFIPEDGRKQLTQLFAKLPNPVVLDVFTDGDEKNAFNGYTRRF
AEDISLLVDKISMHHHALDSEEAKRRDVTLSPTLFVGTGEADPKLDYRIRFTGAPLGEEG
RALVESIFLVSLRQSGLTETSRRILSELKEPRKPRVFSSPGCPYCPGQFMHAAKCAIERP
GLVEAECVNSDEFPDLSKKYGVGSVPHTQYDDTYKAIGLMPEERFVLELVTLKSADELMR
EHGMEPGHEGHDHAHGAHGMDPEGLDVVETDMVVLGAGPAGLSAAIYGERSGMKTVVLDK
SVVGGQVTVTPVVENYPGFTDIAGLKLVEVLSAHARQYATVREGETVHEVKIGKLIEVYT
NRAVYLCKALVFATGAQWRKLDAPGEGRFYGRGVSYCASCDGFMYRGKRVAMIGGGNSAL
TDALHLKNLGADVTIIHRRDSFRAEKALQDSLEREGIAVIWDTVVEEILGDTVAPVREGD
GGDGKDAAPGTAPAEPDTGVVRGIRVRNVKTDAVSELPFDGVFVAIGHIPNSEQAAELGV
VLEKDGSIKVDRHMRTNIPRIYAAGDVTGGVRQIVTAVGSGATAALAAFEDTQNPYWKKK
GE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory