Comparing 8501378 FitnessBrowser__Miya:8501378 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
34% identity, 97% coverage: 9:315/316 of query aligns to 21:319/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
34% identity, 97% coverage: 9:315/316 of query aligns to 20:308/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
33% identity, 93% coverage: 2:294/316 of query aligns to 13:305/330 of P0AAH4
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 77% coverage: 10:253/316 of query aligns to 17:247/250 of 7z18I
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 77% coverage: 10:253/316 of query aligns to 17:247/253 of 7z15I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 77% coverage: 10:253/316 of query aligns to 17:247/250 of 7z16I
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 80% coverage: 1:253/316 of query aligns to 10:244/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
34% identity, 80% coverage: 1:253/316 of query aligns to 11:245/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
34% identity, 80% coverage: 1:253/316 of query aligns to 11:245/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
34% identity, 80% coverage: 1:253/316 of query aligns to 11:245/344 of 6cvlD
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 78% coverage: 11:255/316 of query aligns to 21:248/375 of 2d62A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 76% coverage: 15:253/316 of query aligns to 36:251/378 of P69874
Sites not aligning to the query:
1g291 Malk (see paper)
34% identity, 78% coverage: 11:255/316 of query aligns to 18:245/372 of 1g291
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 81% coverage: 16:271/316 of query aligns to 46:279/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 81% coverage: 16:271/316 of query aligns to 46:279/382 of 7aheC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
33% identity, 78% coverage: 6:252/316 of query aligns to 13:236/362 of 8hprD
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
33% identity, 78% coverage: 6:252/316 of query aligns to 13:236/363 of 8hprC
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 77% coverage: 11:253/316 of query aligns to 20:244/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 77% coverage: 11:253/316 of query aligns to 20:244/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 77% coverage: 11:253/316 of query aligns to 20:244/353 of 1oxuA
Sites not aligning to the query:
>8501378 FitnessBrowser__Miya:8501378
MFDPTPAVLRAVDGVSLTLDRGRTLGLVGESGCGKSTLARMVVGLLPPSAGQVLLDGRLF
AGTDGDAANGGASGHSADLAISRAEAAQLVQMVFQDPFSSLNPRRTVGASIGEALAVAGV
PGPERRAKVADMLQLVGLRAEHADRYPHEFSGGQRQRVAVARALITHPALVVCDEPVSSL
DASVQAQVLNLLRELQEHMGLAYLFISHDLGVVGHMSDHVAVMYLGKVVEEAPRDVLFAA
PAHPYTRALLASVPVRDPSRRAEHPALSGDLPSPIAPPPGCPFHPRCPQVMDVCRRQVPG
WHVVAEGQHARCHLHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory