Comparing 8501405 FitnessBrowser__Miya:8501405 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
67% identity, 83% coverage: 58:359/365 of query aligns to 1:302/304 of 4xeqB
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
41% identity, 75% coverage: 59:330/365 of query aligns to 2:274/301 of 4pdhA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
40% identity, 76% coverage: 56:332/365 of query aligns to 2:279/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
40% identity, 76% coverage: 56:332/365 of query aligns to 1:278/303 of 4p9kA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
42% identity, 73% coverage: 59:323/365 of query aligns to 2:267/301 of 4nq8B
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
39% identity, 75% coverage: 60:331/365 of query aligns to 1:275/303 of 4pddA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
35% identity, 68% coverage: 76:323/365 of query aligns to 22:270/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
35% identity, 68% coverage: 76:323/365 of query aligns to 22:270/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
35% identity, 68% coverage: 76:323/365 of query aligns to 22:270/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
35% identity, 68% coverage: 76:323/365 of query aligns to 22:270/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
35% identity, 68% coverage: 76:323/365 of query aligns to 23:271/310 of 7bbrA
Sites not aligning to the query:
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
28% identity, 75% coverage: 78:352/365 of query aligns to 19:294/300 of 4pf8A
Sites not aligning to the query:
4ovqA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d- glucuronate (see paper)
28% identity, 79% coverage: 70:357/365 of query aligns to 12:300/302 of 4ovqA
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
31% identity, 72% coverage: 60:322/365 of query aligns to 2:266/306 of 4xfeA
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
31% identity, 69% coverage: 82:332/365 of query aligns to 55:304/330 of Q128M1
Sites not aligning to the query:
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
31% identity, 69% coverage: 82:332/365 of query aligns to 25:274/301 of 4mhfA
Sites not aligning to the query:
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
31% identity, 69% coverage: 82:332/365 of query aligns to 25:274/302 of 4mijA
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
28% identity, 77% coverage: 78:358/365 of query aligns to 20:301/303 of 4p3lA
Sites not aligning to the query:
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
30% identity, 75% coverage: 84:358/365 of query aligns to 26:298/298 of 4ovrA
Sites not aligning to the query:
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
32% identity, 74% coverage: 69:338/365 of query aligns to 10:278/300 of 4n8yA
Sites not aligning to the query:
>8501405 FitnessBrowser__Miya:8501405
MHRRFRTFGQPCPLRLSRLLSFAGACRRRGRALAASLGLMLACLAAILPGWPRTASAATE
LTLAVVTTPGSAQHVCAERFRQLLEERSHGAYRVVVHHSGTLGTETEILQQLQLGGVQLA
IITLGVLDPFVPEVKVLDYPFLFRDAAEADRVLDGATGRALLDALERVGLKGLHFSENGF
RHLTNNVRPVRSVDDVRGLKIRVLESTLHRELWRALGANPTPMGWPIYAELQQGTIDGQE
NPLWVMAEYRMPEVQKYLSLTGHVYSAHADLANLAWFNGLPPAERTLVMQCMADAAAYQR
AYNRQKDADYLRRLREAGMQVVDAPDLASFRARADALRQSSLFSDPRTRDMLARVLAAVG
RQGAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory