SitesBLAST
Comparing 8501453 FitnessBrowser__Miya:8501453 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
64% identity, 100% coverage: 1:730/731 of query aligns to 4:728/728 of 5oasA
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
64% identity, 100% coverage: 2:730/731 of query aligns to 1:724/724 of 5vfbA
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
62% identity, 99% coverage: 1:727/731 of query aligns to 1:724/741 of P9WK16
- R339 (= R344) active site, Proton acceptor
- D633 (= D636) active site, Proton donor
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
62% identity, 99% coverage: 2:727/731 of query aligns to 1:717/720 of 2gq3A
- active site: D267 (= D276), E269 (= E278), R335 (= R344), E430 (= E436), D458 (= D464), D626 (= D636)
- binding coenzyme a: V114 (= V118), V115 (= V119), R121 (= R125), F122 (≠ Y126), N125 (= N129), A126 (= A130), K301 (= K310), R308 (= R317), P539 (= P545), P541 (= P547), C612 (= C622), M624 (= M634), D626 (= D636)
- binding magnesium ion: H370 (= H379), K373 (≠ R382), N378 (vs. gap), G379 (vs. gap), L381 (≠ V387), E430 (= E436), D458 (= D464)
6dkoA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-f-phenyldiketoacid (see paper)
62% identity, 99% coverage: 2:727/731 of query aligns to 1:713/716 of 6dkoA
- active site: D270 (= D276), E272 (= E278), R332 (= R344), E424 (= E436), D452 (= D464), D622 (= D636)
- binding 4-(2,6-difluorophenyl)-2,4-dioxobutanoic acid: R332 (= R344), G449 (= G461), L451 (= L463), D452 (= D464), M505 (= M517), W531 (= W543), M620 (= M634), D622 (= D636)
- binding magnesium ion: E424 (= E436), D452 (= D464)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
62% identity, 99% coverage: 2:727/731 of query aligns to 1:709/712 of 6dnpA
- active site: D270 (= D276), E272 (= E278), R328 (= R344), E419 (= E436), D447 (= D464), D618 (= D636)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R344), E419 (= E436), G444 (= G461), L446 (= L463), D447 (= D464), M500 (= M517), W526 (= W543), M616 (= M634), D618 (= D636)
- binding magnesium ion: E419 (= E436), D447 (= D464)
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:714/717 of 5c9rA
- active site: D270 (= D276), E272 (= E278), R331 (= R344), E424 (= E436), D452 (= D464), D623 (= D636)
- binding 3-[(4-chlorophenyl)sulfanyl]propanoic acid: V117 (= V118), E424 (= E436), D452 (= D464), M505 (= M517), W531 (= W543), M621 (= M634), D623 (= D636)
- binding magnesium ion: E424 (= E436), D452 (= D464)
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
61% identity, 99% coverage: 4:727/731 of query aligns to 2:709/712 of 6bu1A
- active site: D269 (= D276), E271 (= E278), R327 (= R344), E419 (= E436), D447 (= D464), D618 (= D636)
- binding (2Z)-4-(2-bromo-3-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V116 (= V118), R327 (= R344), E419 (= E436), G444 (= G461), L446 (= L463), D447 (= D464), M500 (= M517), W526 (= W543), M616 (= M634), D618 (= D636)
- binding magnesium ion: E419 (= E436), D447 (= D464), V463 (= V480), R464 (= R481)
5cakA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-3-(1h-indol-3-yl)propanoic acid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:714/717 of 5cakA
- active site: D270 (= D276), E272 (= E278), R329 (= R344), E424 (= E436), D452 (= D464), D623 (= D636)
- binding (2R)-2-hydroxy-3-(1H-indol-3-yl)propanoic acid: V117 (= V118), L451 (= L463), M505 (= M517), E622 (= E635), D623 (= D636)
- binding magnesium ion: E424 (= E436), D452 (= D464)
5drcA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-3-yl)-4-oxobut-2-enoic acid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:713/716 of 5drcA
- active site: D270 (= D276), E272 (= E278), R330 (= R344), E423 (= E436), D451 (= D464), D622 (= D636)
- binding (2Z)-2-hydroxy-4-(1H-indol-3-yl)-4-oxobut-2-enoic acid: R330 (= R344), E423 (= E436), G448 (= G461), L450 (= L463), D451 (= D464), M504 (= M517), W530 (= W543), M620 (= M634), D622 (= D636)
- binding magnesium ion: E423 (= E436), D451 (= D464), R468 (= R481), T471 (≠ A484)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:716/719 of 5cbiA
- active site: D270 (= D276), E272 (= E278), R331 (= R344), E426 (= E436), D454 (= D464), D625 (= D636)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L54), N54 (≠ A55), D57 (≠ A58), F125 (≠ Y126), Y138 (= Y139), D139 (= D140), Y142 (= Y143), M507 (= M517), W533 (= W543), P535 (= P545), A611 (≠ C622), M623 (= M634), M623 (= M634), E624 (= E635), D625 (= D636)
- binding magnesium ion: E426 (= E436), D454 (= D464)
6c2xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-6-me-phenyldiketoacid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:708/711 of 6c2xA
- active site: D268 (= D276), E270 (= E278), R328 (= R344), E418 (= E436), D446 (= D464), D617 (= D636)
- binding (2S)-4-(2-bromo-6-methylphenyl)-2-hydroxy-4-oxobutanoic acid: V115 (= V118), R328 (= R344), E418 (= E436), G443 (= G461), L445 (= L463), D446 (= D464), M499 (= M517), W525 (= W543), M615 (= M634), D617 (= D636)
- binding magnesium ion: E418 (= E436), D446 (= D464)
5t8gA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-oxo-4-((thiophene-2-carbonyl)oxy)butanoic acid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:711/714 of 5t8gA
- active site: D270 (= D276), E272 (= E278), R328 (= R344), E421 (= E436), D449 (= D464), D620 (= D636)
- binding (3E)-2-oxo-4-[(thiophen-2-ylcarbonyl)oxy]but-3-enoic acid: V117 (= V118), R328 (= R344), E421 (= E436), G446 (= G461), L448 (= L463), D449 (= D464), M502 (= M517), W528 (= W543), E619 (= E635), D620 (= D636)
- binding magnesium ion: E421 (= E436), D449 (= D464), R466 (= R481), T469 (≠ A484)
5dx7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(5-chlorothiophen-2-yl)isoxazole-3-carboxylic acid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:711/714 of 5dx7A
- active site: D270 (= D276), E272 (= E278), R328 (= R344), E421 (= E436), D449 (= D464), D620 (= D636)
- binding 5-(5-chlorothiophen-2-yl)-1,2-oxazole-3-carboxylic acid: V117 (= V118), M502 (= M517), M618 (= M634), D620 (= D636)
- binding magnesium ion: E421 (= E436), D449 (= D464)
5c9uA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-(2-(2,4-dichlorophenyl)hydrazinyl)-2-oxoacetic acid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:711/714 of 5c9uA
- active site: D270 (= D276), E272 (= E278), R328 (= R344), E421 (= E436), D449 (= D464), D620 (= D636)
- binding [2-(2,4-dichlorophenyl)hydrazinyl](oxo)acetic acid: E421 (= E436), G446 (= G461), L448 (= L463), D449 (= D464), M502 (= M517), W528 (= W543), M618 (= M634), E619 (= E635), D620 (= D636)
- binding magnesium ion: E421 (= E436), D449 (= D464)
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:708/711 of 5cjmA
- active site: D270 (= D276), E272 (= E278), R328 (= R344), E418 (= E436), D446 (= D464), D617 (= D636)
- binding 4h-thieno[3,2-b]pyrole-5-carboxylic acid: V117 (= V118), S274 (= S280), M499 (= M517), E616 (= E635), D617 (= D636)
- binding magnesium ion: E418 (= E436), D446 (= D464)
5cc3A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6-bromo-1h-indole-2-carboxylic acid
61% identity, 99% coverage: 2:727/731 of query aligns to 1:712/715 of 5cc3A
- active site: D270 (= D276), E272 (= E278), R328 (= R344), E422 (= E436), D450 (= D464), D621 (= D636)
- binding 6-bromanyl-1H-indole-2-carboxylic acid: V117 (= V118), M503 (= M517), M619 (= M634), D621 (= D636)
- binding magnesium ion: E422 (= E436), D450 (= D464), V466 (= V480), R467 (= R481), T470 (≠ A484)
6c8pA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-phenyldiketoacid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:713/716 of 6c8pA
- active site: D270 (= D276), E272 (= E278), R329 (= R344), E423 (= E436), D451 (= D464), D622 (= D636)
- binding (2Z)-4-(2-fluorophenyl)-2-hydroxy-4-oxobut-2-enoic acid: R329 (= R344), E423 (= E436), G448 (= G461), L450 (= L463), D451 (= D464), M504 (= M517), W530 (= W543), M620 (= M634), D622 (= D636)
- binding magnesium ion: E423 (= E436), D451 (= D464)
5c9wA Crystal structure of mycobacterium tuberculosis malate synthase in complex with (z)-n-(2-bromophenyl)-2-(hydroxyimino)acetamide (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:710/713 of 5c9wA
- active site: D269 (= D276), E271 (= E278), R327 (= R344), E420 (= E436), D448 (= D464), D619 (= D636)
- binding (2E)-N-(2-bromophenyl)-2-(hydroxyimino)acetamide: V116 (= V118), R327 (= R344), M501 (= M517), W527 (= W543), M617 (= M634), D619 (= D636)
- binding magnesium ion: E420 (= E436), D448 (= D464), V464 (= V480), R465 (= R481), T468 (≠ A484)
6dl9A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-cl-phenyldiketoacid (see paper)
61% identity, 99% coverage: 2:727/731 of query aligns to 1:713/716 of 6dl9A
- active site: D270 (= D276), E272 (= E278), R328 (= R344), E423 (= E436), D451 (= D464), D622 (= D636)
- binding 4-(2,6-dichlorophenyl)-2,4-dioxobutanoic acid: V117 (= V118), R328 (= R344), E423 (= E436), G448 (= G461), L450 (= L463), D451 (= D464), M504 (= M517), W530 (= W543), M620 (= M634), D622 (= D636)
- binding magnesium ion: E423 (= E436), D451 (= D464)
Query Sequence
>8501453 FitnessBrowser__Miya:8501453
MTQRVQVGGLQIAAPLYDVIVRDIAPGTGVDPDRFWTALENMVETMADRNRALLAKRAEL
QDAIDAWHRERRGTPHDGAAYEAFLRSIGYLVPEGPDFAVTTEGVDPEIALVAGPQLVVP
ITNARYALNAANARWGSLYDALYGTDVIPEDPARGGAPRGGAYNPARGALVVARAAAFLD
EAFPLATGSHADAARYDVRGGKLAVILKDGAETGLADPARFVGHAGDPAGGNGAVLLRNH
GLHAEIRIDREHAIGRGHAAGVRDVVMEAAMTTILDCEDSVAVVDGADKALAYRNMLGLF
RGDLSAEFPKGGRSVLRTLNPDREYTGPDGAAFSLPGRSLLLVRTVGHLMTTDAVLARSG
EEIPEGMLDTMATAYIALHDLRGTSSVRNSRTGGVYIVKPKQHGPEEVAFTVELFRMAED
ALGMPRNTLKIGIMDEERRTTVNLKECIRAAAERVIFINTGFLDRTGDEIHTCMEAGPVV
RKNAMRGERWIIAYEDWNVDTGLACGLAGRAQVGKGMWAKPDMMREMVETKIGHPRAGAN
CAWVPSPTAATLHAMHYHAVDVAAVQKTLAGQRRATLADLLTLPLMGPASRPTPQEVEEE
LANNAQSILGYVVRWVEQGIGCSKVPDITDVGLMEDRATLRISSQHIANWLHHGICTRDQ
VVAVLKRMAAVVDRQNAGDPAYRPMSADFDASVAFQAACDLVLLGREQPSGYTEPILHAR
RQEAKAKFGII
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory