SitesBLAST
Comparing 8501513 FitnessBrowser__Miya:8501513 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
69% identity, 87% coverage: 46:426/440 of query aligns to 1:381/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H126), K82 (= K127), Q109 (= Q154), S185 (= S230), G227 (= G272), G229 (= G274), S230 (= S275), N231 (= N276), E345 (= E390), S371 (= S416), G372 (= G417)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:378/388 of 5dw0A
- active site: K82 (= K127), E104 (= E149), S371 (= S416)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H126), K82 (= K127), T105 (= T150), G106 (= G151), A107 (= A152), Q109 (= Q154), H110 (= H155), S185 (= S230), G227 (= G272), G229 (= G274), S230 (= S275), N231 (= N276), G298 (= G343), D300 (= D345), E345 (= E390), S371 (= S416)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:378/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:378/386 of 1v8zA
- active site: K82 (= K127), E104 (= E149), S371 (= S416)
- binding pyridoxal-5'-phosphate: H81 (= H126), K82 (= K127), Q109 (= Q154), S185 (= S230), G227 (= G272), G228 (= G273), G229 (= G274), S230 (= S275), N231 (= N276), E345 (= E390), S371 (= S416), G372 (= G417)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:378/385 of 6am8B
- active site: K82 (= K127), E104 (= E149), S371 (= S416)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H126), K82 (= K127), E104 (= E149), T105 (= T150), G106 (= G151), A107 (= A152), Q109 (= Q154), H110 (= H155), L161 (= L206), S185 (= S230), V187 (= V232), G227 (= G272), G228 (= G273), G229 (= G274), S230 (= S275), N231 (= N276), G298 (= G343), Y301 (= Y346), E345 (= E390), S371 (= S416), G372 (= G417)
- binding tryptophan: P12 (= P57), L169 (= L214), S274 (≠ M319), H275 (= H320)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:377/383 of 5dw3A
- active site: K82 (= K127), E104 (= E149), S370 (= S416)
- binding tryptophan: K82 (= K127), E104 (= E149), T105 (= T150), G106 (= G151), A107 (= A152), Q109 (= Q154), H110 (= H155), S185 (= S230), G228 (= G273), Y300 (= Y346)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:378/384 of 7rnpA
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:376/383 of 5t6mA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:376/394 of 5ixjD
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:378/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H126), K82 (= K127), T105 (= T150), G106 (= G151), A107 (= A152), Q109 (= Q154), H110 (= H155), S185 (= S230), G227 (= G272), G229 (= G274), S230 (= S275), N231 (= N276), G298 (= G343), E345 (= E390), S371 (= S416)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:378/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H126), K82 (= K127), T105 (= T150), G106 (= G151), A107 (= A152), Q109 (= Q154), H110 (= H155), S185 (= S230), G227 (= G272), G229 (= G274), S230 (= S275), N231 (= N276), G298 (= G343), E345 (= E390), S371 (= S416)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
63% identity, 85% coverage: 48:423/440 of query aligns to 3:376/383 of 5vm5D
- active site: K82 (= K127), E104 (= E149), S369 (= S416)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H126), K82 (= K127), T105 (= T150), G106 (= G151), A107 (= A152), Q109 (= Q154), H110 (= H155), S185 (= S230), G227 (= G272), G229 (= G274), S230 (= S275), N231 (= N276), G296 (= G343), E343 (= E390), S369 (= S416)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
56% identity, 87% coverage: 42:423/440 of query aligns to 9:393/404 of 6usaB
- active site: K97 (= K127), E119 (= E149), S386 (= S416)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H126), K97 (= K127), T120 (= T150), G121 (= G151), A122 (= A152), G123 (= G153), Q124 (= Q154), H125 (= H155), T200 (≠ S230), G242 (= G272), G244 (= G274), S245 (= S275), N246 (= N276), G313 (= G343), E360 (= E390), S386 (= S416)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L214), W187 (= W217), Y196 (= Y226), F198 (≠ L228), G203 (= G233), P204 (= P234), F207 (≠ Y237), H290 (= H320), G291 (= G321)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
56% identity, 87% coverage: 42:423/440 of query aligns to 9:393/404 of 6dweB
- active site: K97 (= K127), E119 (= E149), S386 (= S416)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L214), Y196 (= Y226), F198 (≠ L228), P204 (= P234), F207 (≠ Y237), H290 (= H320)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H126), K97 (= K127), T120 (= T150), G121 (= G151), A122 (= A152), G123 (= G153), Q124 (= Q154), H125 (= H155), T200 (≠ S230), G242 (= G272), G244 (= G274), S245 (= S275), N246 (= N276), G313 (= G343), E360 (= E390), S386 (= S416)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
56% identity, 87% coverage: 42:423/440 of query aligns to 9:393/405 of 6uapB
- active site: K97 (= K127), E119 (= E149), S386 (= S416)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ V210), N181 (≠ D211), F184 (≠ L214), Y196 (= Y226), F198 (≠ L228), P204 (= P234), F207 (≠ Y237), H290 (= H320)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
56% identity, 87% coverage: 42:423/440 of query aligns to 5:389/399 of 5ocwB
- active site: K93 (= K127), E115 (= E149), S382 (= S416)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H126), K93 (= K127), T116 (= T150), G117 (= G151), A118 (= A152), Q120 (= Q154), H121 (= H155), T196 (≠ S230), G238 (= G272), G240 (= G274), S241 (= S275), N242 (= N276), G309 (= G343), E356 (= E390), S382 (= S416)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
56% identity, 87% coverage: 42:423/440 of query aligns to 10:394/405 of 6u6cB
- active site: K98 (= K127), E120 (= E149), S387 (= S416)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H126), K98 (= K127), T121 (= T150), G122 (= G151), A123 (= A152), Q125 (= Q154), H126 (= H155), T201 (≠ S230), G243 (= G272), G245 (= G274), S246 (= S275), N247 (= N276), G314 (= G343), E361 (= E390), S387 (= S416)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (= Y55), F185 (≠ L214), W188 (= W217), Y197 (= Y226), F199 (≠ L228), G204 (= G233), P205 (= P234), H291 (= H320), G292 (= G321)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
56% identity, 87% coverage: 42:423/440 of query aligns to 10:394/406 of 5tciH
- active site: K98 (= K127), E120 (= E149), S387 (= S416)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (= P57), L31 (≠ I60), Y197 (= Y226), F199 (≠ L228), P205 (= P234), F208 (≠ Y237), H291 (= H320)
5kzmB Crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis (see paper)
55% identity, 88% coverage: 45:431/440 of query aligns to 5:391/395 of 5kzmB
2clfB Tryptophan synthase in complex with n-(4'- trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6) - highf6 complex (see paper)
56% identity, 88% coverage: 48:432/440 of query aligns to 8:392/394 of 2clfB
- active site: K86 (= K127), E108 (= E149), S376 (= S416)
- binding 2-{[4-(trifluoromethoxy)benzoyl]amino}ethyl dihydrogen phosphate: P17 (= P57), E108 (= E149), T109 (= T150), G110 (= G151), H114 (= H155), L165 (= L206), C169 (≠ V210), L187 (= L228), G188 (= G229), T189 (≠ S230), F279 (≠ H320)
- binding pyridoxal-5'-phosphate: H85 (= H126), K86 (= K127), T189 (≠ S230), G231 (= G272), G232 (= G273), G233 (= G274), S234 (= S275), N235 (= N276), E349 (= E390), S376 (= S416), G377 (= G417)
Sites not aligning to the query:
Query Sequence
>8501513 FitnessBrowser__Miya:8501513
MSIIPRMFPAGVTYGATLPTDGGCACAAAARAASLATPPAPPAADGLFGPYGGQYVPEHI
KPVLDELAATFERYHADPDFLAELEYYLTRYSGRQTPLFLCANLTARLGGAKIYLKREDL
NHLGAHKVNNTIGQILLAKRMGKKKVIAETGAGQHGVATAATAALMGMQCTIHMGAEDME
RQKLNVFRMRMMGAEVVPAMSGQRTLKEAVDEALAAWLGDAENTFYLLGSAVGPHPYPRI
VRHFQSVIGREARAQMLEAEGRLPDCAVACVGGGSNAIGLFAEFIADEGVRLIGVEPAGR
GLTYGDHAATLCMGTPGVMHGFHSYMLKDEAGEPAAVYSISAGLDYPGVGPEHSHLKDIG
RAEYASVTDAEALDAFFILSRTEGIIPALESSHALAHAMKLAPALGRDAIILVNLSGRGD
KDVAQVEEMVSAGLVTPPKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory