SitesBLAST
Comparing 8501561 FitnessBrowser__Miya:8501561 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
67% identity, 100% coverage: 1:342/342 of query aligns to 2:341/341 of 1sb8A
- active site: S142 (= S141), S143 (= S142), S144 (= S143), Y166 (= Y165), K170 (= K169), N204 (≠ F203)
- binding nicotinamide-adenine-dinucleotide: G23 (= G22), G26 (= G25), F27 (= F26), I28 (= I27), D47 (= D46), N48 (= N47), F49 (= F48), T51 (= T50), G52 (= G51), D78 (= D77), I79 (= I78), Q98 (= Q97), A100 (= A99), T117 (≠ S116), A140 (= A139), A141 (= A140), Y166 (= Y165), K170 (= K169), Y193 (= Y192), N195 (= N194), V196 (= V195)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S102), S142 (= S141), S143 (= S142), S144 (= S143), Y166 (= Y165), N195 (= N194), A209 (= A208), V210 (= V209), W214 (= W213), Y225 (≠ F224), I226 (= I225), N227 (= N226), R234 (= R233), L271 (= L271), R299 (= R300), D302 (= D303), S306 (= S307)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
67% identity, 100% coverage: 1:342/342 of query aligns to 1:340/340 of 1sb9A
- active site: S141 (= S141), S142 (= S142), S143 (= S143), Y165 (= Y165), K169 (= K169), N203 (≠ F203)
- binding nicotinamide-adenine-dinucleotide: G22 (= G22), G25 (= G25), F26 (= F26), I27 (= I27), D46 (= D46), N47 (= N47), F48 (= F48), T50 (= T50), G51 (= G51), D77 (= D77), I78 (= I78), Q97 (= Q97), A99 (= A99), T116 (≠ S116), A139 (= A139), A140 (= A140), Y165 (= Y165), K169 (= K169), Y192 (= Y192), N194 (= N194), V195 (= V195)
- binding uridine-5'-diphosphate-glucose: S141 (= S141), Y165 (= Y165), N194 (= N194), A208 (= A208), V209 (= V209), W213 (= W213), Y224 (≠ F224), I225 (= I225), N226 (= N226), L270 (= L271), R298 (= R300), D301 (= D303)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
62% identity, 100% coverage: 1:342/342 of query aligns to 5:344/345 of Q7BJX9
- GVAGFI 26:31 (= GVAGFI 22:27) binding
- DNFSTG 50:55 (≠ DNFATG 46:51) binding
- DI 81:82 (= DI 77:78) binding
- QAA 101:103 (= QAA 97:99) binding
- T120 (≠ S116) binding
- SS 145:146 (= SS 141:142) binding
- S147 (= S143) mutation to T: No effect on epimerase activity.
- Y169 (= Y165) binding
- K173 (= K169) binding
- YFN 196:198 (= YFN 192:194) binding
- V199 (= V195) binding
- VIPK 213:216 (≠ VIPQ 209:212) binding
- YIN 228:230 (≠ FIN 224:226) binding
- S236 (= S232) mutation to G: No effect on epimerase activity.
- R237 (= R233) binding
- R271 (= R268) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ RFGD 300:303) binding
- R307 (= R305) mutation to A: No effect on epimerase activity.
- H308 (= H306) mutation to A: No effect on epimerase activity.
- S309 (= S307) mutation to Y: Abolishes epimerase activity.
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
61% identity, 100% coverage: 1:342/342 of query aligns to 2:336/336 of 3ruhA
- active site: S142 (= S141), S143 (= S142), S144 (= S143), Y166 (= Y165), K170 (= K169), N204 (≠ F203)
- binding nicotinamide-adenine-dinucleotide: G23 (= G22), G26 (= G25), F27 (= F26), I28 (= I27), D47 (= D46), N48 (= N47), S50 (≠ A49), T51 (= T50), G52 (= G51), D78 (= D77), I79 (= I78), Q98 (= Q97), A99 (= A98), A100 (= A99), T117 (≠ S116), A140 (= A139), A141 (= A140), S142 (= S141), Y166 (= Y165), K170 (= K169), Y193 (= Y192), V196 (= V195)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (= G101), S103 (= S102), S142 (= S141), S143 (= S142), S144 (= S143), Y166 (= Y165), Y193 (= Y192), N195 (= N194), A209 (= A208), V210 (= V209), K213 (≠ Q212), W214 (= W213), Y225 (≠ F224), I226 (= I225), N227 (= N226), R234 (= R233), L271 (= L271), R294 (= R300), D297 (= D303), V298 (= V304), S301 (= S307)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
61% identity, 100% coverage: 1:342/342 of query aligns to 2:336/336 of 3rufA
- active site: S142 (= S141), S143 (= S142), S144 (= S143), Y166 (= Y165), K170 (= K169), N204 (≠ F203)
- binding nicotinamide-adenine-dinucleotide: G23 (= G22), G26 (= G25), F27 (= F26), I28 (= I27), D47 (= D46), N48 (= N47), S50 (≠ A49), T51 (= T50), G52 (= G51), D78 (= D77), I79 (= I78), Q98 (= Q97), A99 (= A98), A100 (= A99), T117 (≠ S116), A140 (= A139), Y166 (= Y165), K170 (= K169), Y193 (= Y192), V196 (= V195)
- binding uridine-5'-diphosphate: N195 (= N194), A209 (= A208), V210 (= V209), K213 (≠ Q212), W214 (= W213), Y225 (≠ F224), I226 (= I225), N227 (= N226), R234 (= R233), L271 (= L271), R294 (= R300), D297 (= D303)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
61% identity, 100% coverage: 1:342/342 of query aligns to 2:336/336 of 3lu1A
- active site: S142 (= S141), S143 (= S142), S144 (= S143), Y166 (= Y165), K170 (= K169), N204 (≠ F203)
- binding glycine: Q135 (≠ K134), K187 (= K186)
- binding nicotinamide-adenine-dinucleotide: G23 (= G22), G26 (= G25), F27 (= F26), I28 (= I27), D47 (= D46), N48 (= N47), S50 (≠ A49), T51 (= T50), G52 (= G51), D78 (= D77), I79 (= I78), Q98 (= Q97), A99 (= A98), A100 (= A99), A140 (= A139), A141 (= A140), S142 (= S141), Y166 (= Y165), K170 (= K169), Y193 (= Y192), N195 (= N194)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S102), S142 (= S141), S143 (= S142), S144 (= S143), Y166 (= Y165), N195 (= N194), V210 (= V209), W214 (= W213), Y225 (≠ F224), I226 (= I225), N227 (= N226), R234 (= R233), L271 (= L271), R294 (= R300), D297 (= D303)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
37% identity, 95% coverage: 19:342/342 of query aligns to 4:309/309 of 4zrnA
- active site: T117 (≠ S141), G119 (vs. gap), A120 (≠ S143), Y143 (= Y165), K147 (= K169), Y181 (≠ F203), G185 (≠ A208)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (= F26), I12 (= I27), D31 (= D46), N32 (= N47), S34 (≠ A49), S35 (≠ T50), G36 (= G51), S51 (≠ D77), I52 (= I78), L73 (≠ Q97), A74 (= A98), A75 (= A99), T92 (≠ S116), S115 (≠ A139), S116 (≠ A140), Y143 (= Y165), K147 (= K169), Y170 (= Y192), V173 (= V195)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S141), G119 (vs. gap), A120 (≠ S143), Y143 (= Y165), N172 (= N194), G185 (≠ A208), V186 (= V209), H201 (≠ F224), F203 (≠ N226), Y208 (≠ T231), R210 (= R233), V244 (≠ L271), R267 (= R300), D270 (= D303)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
34% identity, 95% coverage: 16:341/342 of query aligns to 4:310/310 of 6dntA
- active site: S120 (= S141), S121 (= S142), A122 (≠ S143), Y144 (= Y165), K148 (= K169), A187 (= A208)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ G101), S120 (= S141), S121 (= S142), Y144 (= Y165), F172 (= F193), N173 (= N194), A187 (= A208), V188 (= V209), K191 (≠ Q212), V203 (≠ F224), I204 (= I225), Y205 (≠ N226), Q210 (≠ T231), R212 (= R233), I246 (≠ L271), R269 (= R300), D272 (= D303)
- binding nicotinamide-adenine-dinucleotide: G10 (= G22), G13 (= G25), F14 (= F26), I15 (= I27), D33 (= D46), N34 (= N47), L35 (≠ F48), S36 (≠ A49), S37 (≠ T50), G38 (= G51), D57 (= D77), L58 (≠ I78), L76 (≠ Q97), A77 (= A98), A78 (= A99), A80 (≠ G101), S118 (≠ A139), S119 (≠ A140), Y144 (= Y165), K148 (= K169), Y171 (= Y192), V174 (= V195)
- binding zinc ion: E209 (= E230), H275 (= H306)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
33% identity, 91% coverage: 19:330/342 of query aligns to 5:301/308 of 6wj9B
- active site: A119 (≠ S141), A120 (≠ S142), A121 (≠ S143), F144 (≠ Y165), K148 (= K169)
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), F12 (= F26), I13 (= I27), D32 (= D46), D33 (≠ N47), S35 (≠ A49), T36 (= T50), G37 (= G51), D55 (= D77), A56 (≠ I78), L75 (≠ Q97), A76 (= A98), A77 (= A99), S94 (= S116), A117 (= A139), A119 (≠ S141), F144 (≠ Y165), K148 (= K169), F171 (≠ Y192), F172 (= F193), I174 (≠ V195)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V103), N173 (= N194), G187 (≠ A208), V188 (= V209), F192 (≠ W213), T203 (≠ F224), L204 (≠ I225), F205 (≠ N226), R212 (= R233), L248 (= L271), R271 (= R300), D274 (= D303)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
33% identity, 91% coverage: 19:330/342 of query aligns to 4:300/307 of 6wjaA
- active site: A118 (≠ S141), A119 (≠ S142), A120 (≠ S143), F143 (≠ Y165), K147 (= K169)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (= F26), I12 (= I27), D31 (= D46), D32 (≠ N47), S34 (≠ A49), T35 (= T50), G36 (= G51), A55 (≠ I78), L74 (≠ Q97), A75 (= A98), A76 (= A99), S93 (= S116), F143 (≠ Y165), K147 (= K169), F170 (≠ Y192), F171 (= F193), I173 (≠ V195)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V103), A120 (≠ S143), N172 (= N194), G186 (≠ A208), V187 (= V209), F191 (≠ W213), T202 (≠ F224), F204 (≠ N226), R211 (= R233), L247 (= L271), R270 (= R300), D273 (= D303)
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
35% identity, 93% coverage: 19:337/342 of query aligns to 4:307/311 of 2p5uA
- active site: T117 (≠ S141), G119 (vs. gap), A120 (≠ S143), Y143 (= Y165), K147 (= K169), H181 (≠ F203), G185 (≠ A208)
- binding nicotinamide-adenine-dinucleotide: G10 (= G25), F11 (= F26), I12 (= I27), D31 (= D46), N32 (= N47), L33 (≠ F48), A34 (= A49), T35 (= T50), G36 (= G51), D51 (≠ N70), L52 (≠ F71), Q73 (= Q97), A74 (= A98), A75 (= A99), A77 (≠ G101), S116 (≠ A140), Y143 (= Y165), K147 (= K169), V173 (= V195)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
33% identity, 93% coverage: 19:337/342 of query aligns to 4:308/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (= F26), I12 (= I27), D31 (= D46), N32 (= N47), T35 (= T50), G36 (= G51), D56 (≠ R72), I57 (≠ F73), L77 (≠ Q97), A78 (= A98), A79 (= A99), I81 (≠ G101), T119 (≠ A139), Y146 (= Y165), K150 (= K169), P173 (≠ Y192), N175 (= N194), V176 (= V195)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ G101), R84 (≠ P104), S121 (= S141), G123 (≠ S142), S124 (= S143), Y146 (= Y165), A174 (≠ F193), N175 (= N194), G188 (≠ A208), V189 (= V209), F193 (≠ W213), R204 (≠ F224), V205 (≠ I225), F206 (≠ N226), N211 (≠ S232), R213 (≠ D234), D248 (≠ L271), R271 (= R300)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
33% identity, 93% coverage: 19:337/342 of query aligns to 4:308/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ G101), R84 (≠ P104), S121 (= S141), G123 (≠ S142), Y146 (= Y165), A174 (≠ F193), N175 (= N194), A187 (= A207), G188 (≠ A208), V189 (= V209), F193 (≠ W213), R204 (≠ F224), F206 (≠ N226), N211 (≠ S232), R213 (≠ D234), D248 (≠ L271), R271 (= R300)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (= F26), I12 (= I27), D31 (= D46), N32 (= N47), A34 (= A49), T35 (= T50), G36 (= G51), D56 (≠ R72), I57 (≠ F73), L77 (≠ Q97), A78 (= A98), A79 (= A99), I81 (≠ G101), T119 (≠ A139), Y146 (= Y165), K150 (= K169), P173 (≠ Y192), A174 (≠ F193), V176 (= V195)
- binding uridine-5'-diphosphate-glucose: I81 (≠ G101), R84 (≠ P104), S121 (= S141), G123 (≠ S142), Y146 (= Y165), A174 (≠ F193), N175 (= N194), A187 (= A207), G188 (≠ A208), V189 (= V209), F193 (≠ W213), R204 (≠ F224), F206 (≠ N226), N211 (≠ S232), R213 (≠ D234), D248 (≠ L271), R271 (= R300)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
33% identity, 93% coverage: 19:337/342 of query aligns to 4:308/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (= F26), I12 (= I27), D31 (= D46), N32 (= N47), T35 (= T50), G36 (= G51), D56 (≠ R72), I57 (≠ F73), L77 (≠ Q97), A78 (= A98), A79 (= A99), I81 (≠ G101), V96 (≠ S116), T119 (≠ A139), Y146 (= Y165), K150 (= K169), P173 (≠ Y192), A174 (≠ F193), N175 (= N194), V176 (= V195)
- binding uridine-5'-diphosphate-glucose: I81 (≠ G101), R84 (≠ P104), S121 (= S141), G123 (≠ S142), Y146 (= Y165), A174 (≠ F193), N175 (= N194), A187 (= A207), G188 (≠ A208), V189 (= V209), F193 (≠ W213), R204 (≠ F224), V205 (≠ I225), F206 (≠ N226), R213 (≠ D234), D248 (≠ L271), R271 (= R300)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
31% identity, 99% coverage: 4:340/342 of query aligns to 3:326/336 of 6pnlA
- active site: S133 (= S141), C135 (vs. gap), G136 (≠ S143), Y159 (= Y165), K163 (= K169)
- binding nicotinamide-adenine-dinucleotide: G22 (= G22), G25 (= G25), C26 (≠ F26), D46 (= D46), N47 (= N47), L48 (≠ F48), S49 (≠ A49), S50 (≠ T50), S51 (≠ G51), D68 (= D77), I69 (= I78), L89 (≠ Q97), A91 (= A99), F93 (≠ G101), V108 (≠ S116), S131 (≠ A139), S133 (= S141), Y159 (= Y165), K163 (= K169), F186 (≠ Y192), N188 (= N194), V189 (= V195), R200 (≠ A207)
- binding uridine-5'-diphosphate: N188 (= N194), N201 (≠ A208), V202 (= V209), F206 (≠ W213), P217 (≠ F224), I218 (= I225), T219 (≠ N226), R226 (= R233), V262 (≠ L271), R285 (= R300)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
32% identity, 93% coverage: 19:336/342 of query aligns to 4:309/321 of 6zllA
- active site: T126 (≠ S141), S127 (= S142), S128 (= S143), Y149 (= Y165), K153 (= K169)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (= F26), I12 (= I27), D32 (= D46), H33 (≠ N47), F34 (= F48), I35 (≠ A49), K43 (≠ D57), D62 (= D77), I63 (= I78), L81 (≠ Q97), A82 (= A98), A83 (= A99), I124 (≠ A139), T126 (≠ S141), Y149 (= Y165), K153 (= K169), Y176 (= Y192), V179 (= V195), R185 (≠ D201), M188 (≠ G204)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ G101), V87 (= V103), R88 (≠ P104), T126 (≠ S141), S127 (= S142), Y149 (= Y165), T178 (≠ N194), R185 (≠ D201), A189 (= A205), R192 (≠ A208), T204 (≠ F224), F206 (≠ N226), Q211 (≠ T231), R213 (= R233), I250 (≠ L271), E276 (≠ D303)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
32% identity, 93% coverage: 19:336/342 of query aligns to 4:309/314 of 6zldA
- active site: T126 (≠ S141), S127 (= S142), S128 (= S143), Y149 (= Y165), K153 (= K169)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (= F26), I12 (= I27), D32 (= D46), H33 (≠ N47), F34 (= F48), I35 (≠ A49), K43 (≠ D57), D62 (= D77), I63 (= I78), L81 (≠ Q97), A82 (= A98), A83 (= A99), I124 (≠ A139), T126 (≠ S141), K153 (= K169), Y176 (= Y192), T178 (≠ N194), R185 (≠ D201), M188 (≠ G204)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ G101), R88 (≠ P104), T126 (≠ S141), S127 (= S142), S128 (= S143), Y149 (= Y165), F177 (= F193), T178 (≠ N194), R185 (≠ D201), M188 (≠ G204), A189 (= A205), R192 (≠ A208), T204 (≠ F224), F206 (≠ N226), Q211 (≠ T231), R213 (= R233), I250 (≠ L271), E276 (≠ D303)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
32% identity, 93% coverage: 19:336/342 of query aligns to 4:309/314 of 6zl6A
- active site: T126 (≠ S141), S127 (= S142), S128 (= S143), Y149 (= Y165), K153 (= K169)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (= F26), I12 (= I27), D32 (= D46), H33 (≠ N47), F34 (= F48), I35 (≠ A49), K43 (≠ D57), D62 (= D77), I63 (= I78), L81 (≠ Q97), A82 (= A98), A83 (= A99), I124 (≠ A139), T126 (≠ S141), K153 (= K169), Y176 (= Y192), T178 (≠ N194), V179 (= V195), R185 (≠ D201), M188 (≠ G204)
- binding uridine-5'-diphosphate: T178 (≠ N194), A189 (= A205), R192 (≠ A208), T204 (≠ F224), F206 (≠ N226), Q211 (≠ T231), R213 (= R233), I250 (≠ L271), E276 (≠ D303)
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
31% identity, 94% coverage: 19:340/342 of query aligns to 13:320/330 of 6pmhA
- active site: S127 (= S141), C129 (vs. gap), G130 (≠ S143), Y153 (= Y165), K157 (= K169)
- binding adenosine monophosphate: G16 (= G22), G19 (= G25), D40 (= D46), N41 (= N47), S43 (≠ A49), S44 (≠ T50), S45 (≠ G51), D62 (= D77), I63 (= I78), A84 (= A98), F87 (≠ G101), R194 (≠ A207)
- binding uridine-5'-diphosphate: C129 (vs. gap), N182 (= N194), N195 (≠ A208), V196 (= V209), F200 (≠ W213), P211 (≠ F224), I212 (= I225), T213 (≠ N226), R220 (= R233), V256 (≠ L271), R279 (= R300)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
29% identity, 94% coverage: 18:337/342 of query aligns to 4:315/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), F12 (= F26), I13 (= I27), D32 (= D46), N33 (= N47), N35 (≠ A49), Y38 (= Y52), K43 (≠ D57), D61 (= D77), L62 (≠ I78), L83 (≠ Q97), A84 (= A98), A85 (= A99), A118 (= A139), Y145 (= Y165), K149 (= K169), F172 (≠ Y192), F173 (= F193), T174 (≠ N194), V175 (= V195), R181 (≠ A205)
Query Sequence
>8501561 FitnessBrowser__Miya:8501561
MTRYTALMQELEAAPRTWLVTGVAGFIGSNLLETLLMHGQKVVGLDNFATGYQRNLDMVR
EIVGADLWRNFRFKEGDIRNLEHCREVCEGVDHVLHQAALGSVPRSIEDPILANESNISG
FVNMMVAARDAKVKTFVYAASSSTYGDEPTLPKVEDKIGKPLSPYAVTKYVNELYADVFA
TCYGMKAIGLRYFNVFGKRQDPFGAYAAVIPQWFASLLRGETVFINGDGETSRDFCYIDN
CVQANLLAATATDEAALNTVYNVAFGERTDLNQLFDLIREEVSRHKPEAATAKPEHREFR
FGDVRHSLADISRAHTRLGYEPVYSVRQGLRLSGDWYAANLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory