Comparing 8501597 FitnessBrowser__Miya:8501597 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
36% identity, 38% coverage: 172:277/280 of query aligns to 146:267/276 of Q42565
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
41% identity, 32% coverage: 172:261/280 of query aligns to 78:175/673 of 8hx8A
Sites not aligning to the query:
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
38% identity, 37% coverage: 172:274/280 of query aligns to 78:187/193 of P00900
Sites not aligning to the query:
1i7qB Anthranilate synthase from s. Marcescens (see paper)
38% identity, 37% coverage: 172:274/280 of query aligns to 77:186/192 of 1i7qB
Sites not aligning to the query:
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
33% identity, 46% coverage: 148:275/280 of query aligns to 55:186/187 of P00903
2vxoB Human gmp synthetase in complex with xmp (see paper)
30% identity, 38% coverage: 173:277/280 of query aligns to 77:185/658 of 2vxoB
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
29% identity, 38% coverage: 173:277/280 of query aligns to 99:210/693 of P49915
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
30% identity, 40% coverage: 150:261/280 of query aligns to 46:132/632 of 8hx9A
Sites not aligning to the query:
>8501597 FitnessBrowser__Miya:8501597
MRILLADNHDSFTRNLEHLLVAATGCAPVVVPVDRLGEATTGWPHAPGGPAPAALAARWD
LLVISPGPGTPEEYPQYAPLLGGAATRVERASHMAGTTDTTGTMGATGDDTDDTLLAGQS
AGMVTALAAPPSPDPSVATPAVPAATSSPDQSAVSPSPRRLPHCAPPCPVPVPVLGICLG
LQIINAHFGGVTAPLPGCVHGKPDTLHYAGQARTVARYHSLHLSAMGAGMRVLARNGQGV
VMAARHRCLPLLGYQFHPESFLTPDGVWWIRHALHALGLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory