SitesBLAST
Comparing 8501665 FitnessBrowser__Miya:8501665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
31% identity, 85% coverage: 49:313/313 of query aligns to 22:288/290 of 5mr0D
- active site: F32 (= F59), G34 (≠ S61), K150 (= K175), E183 (= E208), L206 (= L232)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R78), G100 (= G127), L101 (≠ I128), K150 (= K175), Y154 (= Y179), E183 (= E208), G186 (≠ I211), D187 (≠ A212), L206 (= L232), I209 (≠ T235), T210 (= T236), G245 (= G270), T246 (= T271)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
31% identity, 84% coverage: 49:311/313 of query aligns to 23:287/290 of 5e25A
- active site: F33 (= F59), G35 (≠ S61), K151 (= K175), E184 (= E208), L207 (= L232)
- binding 2-oxoglutaric acid: Y88 (≠ S114), K151 (= K175), T247 (= T271), A248 (≠ S272)
- binding pyridoxal-5'-phosphate: R52 (= R78), K151 (= K175), Y155 (= Y179), E184 (= E208), G187 (≠ I211), D188 (≠ A212), L207 (= L232), G209 (= G234), I210 (≠ T235), T211 (= T236), G246 (= G270), T247 (= T271)
7p3tB Transaminase of gamma-proteobacterium (see paper)
30% identity, 78% coverage: 55:298/313 of query aligns to 30:275/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R78), K153 (= K175), R157 (≠ Y179), E186 (= E208), S187 (≠ T209), A188 (= A210), A189 (≠ I211), S190 (≠ A212), G210 (= G234), I211 (≠ T235), T212 (= T236), T248 (= T271)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
27% identity, 80% coverage: 49:299/313 of query aligns to 25:275/297 of 2ej3A
- active site: F35 (= F59), G37 (≠ S61), K150 (≠ R173), E184 (= E208), L207 (= L232)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (≠ I211), G246 (= G270), T247 (= T271), A248 (≠ S272)
- binding pyridoxal-5'-phosphate: R58 (= R78), K150 (≠ R173), Y155 (= Y179), E184 (= E208), G187 (≠ I211), L207 (= L232), G209 (= G234), I210 (≠ T235), T211 (= T236), G246 (= G270), T247 (= T271)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
27% identity, 80% coverage: 49:299/313 of query aligns to 25:275/297 of 2eiyA
- active site: F35 (= F59), G37 (≠ S61), K150 (≠ R173), E184 (= E208), L207 (= L232)
- binding 4-methyl valeric acid: F35 (= F59), Y94 (≠ S114), T247 (= T271), A248 (≠ S272)
- binding pyridoxal-5'-phosphate: R58 (= R78), K150 (≠ R173), Y155 (= Y179), E184 (= E208), G187 (≠ I211), E188 (≠ A212), L207 (= L232), G209 (= G234), I210 (≠ T235), T211 (= T236), G246 (= G270), T247 (= T271)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
27% identity, 80% coverage: 49:299/313 of query aligns to 25:275/297 of 1wrvA
- active site: F35 (= F59), G37 (≠ S61), K150 (≠ R173), E184 (= E208), L207 (= L232)
- binding pyridoxal-5'-phosphate: R58 (= R78), K150 (≠ R173), Y155 (= Y179), E184 (= E208), G187 (≠ I211), L207 (= L232), G209 (= G234), I210 (≠ T235), T211 (= T236), T247 (= T271)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
27% identity, 80% coverage: 49:299/313 of query aligns to 25:272/294 of 2ej2A
- active site: F35 (= F59), G37 (≠ S61), K147 (≠ I174), E181 (= E208), L204 (= L232)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R78), Y94 (≠ S114), Y152 (= Y179), E181 (= E208), G184 (≠ I211), E185 (≠ A212), L204 (= L232), G206 (= G234), I207 (≠ T235), T208 (= T236), T244 (= T271), A245 (≠ S272)
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
27% identity, 80% coverage: 49:299/313 of query aligns to 25:283/305 of 2ej0B
- active site: F35 (= F59), G37 (≠ S61), K158 (≠ I174), E192 (= E208), L215 (= L232)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R78), Y163 (= Y179), E192 (= E208), G195 (≠ I211), E196 (≠ A212), L215 (= L232), G217 (= G234), I218 (≠ T235), T219 (= T236), G254 (= G270), T255 (= T271)
4uugA The (r)-selective amine transaminase from aspergillus fumigatus with inhibitor bound (see paper)
25% identity, 91% coverage: 13:298/313 of query aligns to 15:300/320 of 4uugA
- active site: Y57 (≠ F59), K178 (= K175), E211 (= E208), L233 (= L232)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R76 (= R78), K178 (= K175), E211 (= E208), G214 (≠ I211), F215 (≠ A212), N216 (= N213), L233 (= L232), G235 (= G234), I236 (≠ T235), T237 (= T236), T272 (≠ G270), T273 (= T271), A274 (≠ S272)
4chiA (R)-selective amine transaminase from aspergillus fumigatus at 1.27 a resolution (see paper)
25% identity, 91% coverage: 13:298/313 of query aligns to 15:300/320 of 4chiA
- active site: Y57 (≠ F59), K178 (= K175), E211 (= E208), L233 (= L232)
- binding pyridoxal-5'-phosphate: R76 (= R78), K178 (= K175), E211 (= E208), F215 (≠ A212), L233 (= L232), G235 (= G234), I236 (≠ T235), T237 (= T236), T272 (≠ G270), T273 (= T271)
- binding phosphate ion: R76 (= R78), G235 (= G234), I236 (≠ T235), T237 (= T236), T273 (= T271)
6xwbA Crystal structure of an r-selective transaminase from thermomyces stellatus. (see paper)
28% identity, 81% coverage: 45:298/313 of query aligns to 44:300/319 of 6xwbA
- binding pyridoxal-5'-phosphate: R77 (= R78), K178 (= K175), F185 (≠ N182), E211 (= E208), G214 (≠ I211), F215 (≠ A212), N216 (= N213), L233 (= L232), G235 (= G234), V236 (≠ T235), T237 (= T236), T273 (= T271)
6fteB Crystal structure of an (r)-selective amine transaminase from exophiala xenobiotica
23% identity, 81% coverage: 45:298/313 of query aligns to 44:301/321 of 6fteB
- active site: Y58 (≠ F59), K179 (= K175), E212 (= E208), L234 (= L232)
- binding pyridoxal-5'-phosphate: R77 (= R78), K179 (= K175), E212 (= E208), F216 (≠ A212), N217 (= N213), L234 (= L232), G236 (= G234), V237 (≠ T235), T238 (= T236), T274 (= T271)
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
25% identity, 80% coverage: 50:299/313 of query aligns to 24:282/304 of 1iyeA
- active site: F33 (= F59), G35 (≠ S61), K156 (≠ R173), A157 (≠ K175), E190 (= E208), L214 (= L232)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R78), Y92 (≠ S114), Y126 (vs. gap), K156 (≠ R173), Y161 (= Y179), E190 (= E208), G193 (≠ I211), E194 (≠ A212), N195 (= N213), L214 (= L232), G216 (= G234), I217 (≠ T235), T218 (= T236), G253 (= G270), T254 (= T271), A255 (≠ S272)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
25% identity, 80% coverage: 50:299/313 of query aligns to 24:282/304 of 1iydA
- active site: F33 (= F59), G35 (≠ S61), K156 (≠ R173), A157 (≠ K175), E190 (= E208), L214 (= L232)
- binding glutaric acid: Y92 (≠ S114), Y126 (vs. gap), A255 (≠ S272)
- binding pyridoxal-5'-phosphate: R56 (= R78), K156 (≠ R173), Y161 (= Y179), E190 (= E208), G193 (≠ I211), E194 (≠ A212), L214 (= L232), G216 (= G234), I217 (≠ T235), T218 (= T236), T254 (= T271)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
25% identity, 80% coverage: 50:299/313 of query aligns to 24:282/304 of 1i1mA
- active site: K156 (≠ R173)
- binding 4-methyl valeric acid: Y92 (≠ S114), K156 (≠ R173), T254 (= T271), A255 (≠ S272)
- binding pyridoxal-5'-phosphate: R56 (= R78), K156 (≠ R173), Y161 (= Y179), E190 (= E208), G193 (≠ I211), E194 (≠ A212), L214 (= L232), G216 (= G234), I217 (≠ T235), T218 (= T236), G253 (= G270), T254 (= T271)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
25% identity, 80% coverage: 50:299/313 of query aligns to 24:282/304 of 1i1lA
- active site: K156 (≠ R173)
- binding 2-methylleucine: Y92 (≠ S114), K156 (≠ R173), T254 (= T271), A255 (≠ S272)
- binding pyridoxal-5'-phosphate: R56 (= R78), K156 (≠ R173), Y161 (= Y179), E190 (= E208), G193 (≠ I211), G216 (= G234), I217 (≠ T235), T218 (= T236), T254 (= T271)
8ivpB Crystal structure of mv in complex with llp and fru from mycobacterium vanbaalenii
26% identity, 82% coverage: 54:310/313 of query aligns to 54:314/322 of 8ivpB
8aykA Crystal structure of d-amino acid aminotrensferase from aminobacterium colombiense complexed with d-glutamate (see paper)
27% identity, 84% coverage: 45:308/313 of query aligns to 19:273/276 of 8aykA
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R52 (= R78), R137 (≠ Q168), K143 (= K175), E173 (= E208), S175 (≠ A210), H176 (≠ I211), S177 (≠ A212), L196 (= L232), T199 (= T235), T200 (= T236), G235 (= G270), T236 (= T271)
- binding (~{Z})-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]pent-2-enedioic acid: T35 (≠ S61), R52 (= R78), R137 (≠ Q168), K143 (= K175), E173 (= E208), H176 (≠ I211), S177 (≠ A212), L196 (= L232), G198 (= G234), T199 (= T235), T200 (= T236), G235 (= G270), T236 (= T271), V237 (≠ S272), K238 (≠ S273)
8ayjA Crystal structure of d-amino acid aminotransferase from aminobacterium colombiens complexed with 3-aminooxypropionic acid (see paper)
27% identity, 84% coverage: 45:308/313 of query aligns to 19:273/276 of 8ayjA
- binding 3-[(~{E})-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]oxypropanoic acid: T35 (≠ S61), T35 (≠ S61), R52 (= R78), M87 (≠ S114), R89 (= R116), R137 (≠ Q168), K143 (= K175), Y147 (= Y179), Y147 (= Y179), E173 (= E208), H176 (≠ I211), H176 (≠ I211), S177 (≠ A212), L196 (= L232), G198 (= G234), T199 (= T235), T200 (= T236), G235 (= G270), T236 (= T271), T236 (= T271), V237 (≠ S272), K238 (≠ S273)
- binding pyridoxal-5'-phosphate: R52 (= R78), R137 (≠ Q168), Y147 (= Y179), E173 (= E208), S175 (≠ A210), H176 (≠ I211), S177 (≠ A212), L196 (= L232), G198 (= G234), T199 (= T235), T200 (= T236), T236 (= T271)
8aieA Crystal structure of d-amino acid aminotransferase from aminobacterium colombiense complexed with d-cycloserine
27% identity, 84% coverage: 45:308/313 of query aligns to 19:273/276 of 8aieA
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: T35 (≠ S61), R52 (= R78), K143 (= K175), Y147 (= Y179), S175 (≠ A210), H176 (≠ I211), S177 (≠ A212), T199 (= T235), T200 (= T236), G235 (= G270), T236 (= T271), V237 (≠ S272), K238 (≠ S273)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R52 (= R78), R137 (≠ Q168), K143 (= K175), Y147 (= Y179), E173 (= E208), S177 (≠ A212), L196 (= L232), G198 (= G234), T199 (= T235), T200 (= T236), G235 (= G270), T236 (= T271)
Query Sequence
>8501665 FitnessBrowser__Miya:8501665
MIPVLDTDDYVTRLLSRERPGEAGIIAFYEHRVGAICRNPRLMLMPLDDHLAHRGDGIFE
SMKYLHRRIYQLDAHLERMRRSAAGLYLAPPCTWERLREIIIEVAKAGGEADGSIRVLVG
RGPGGFGIDPAECPEPSLYVAAYHFTPKPEAWFDKGLTAFRSSIPAKQGYLARIKNANYL
PNVLMTREAHERGMDVPFSFDDEGCLAETAIANVALVDQTGTLVVPEFTNALAGTTVLRA
VELAQGEVPVSFRKVREEELHAAREILVLGTSSDCVAVVAYEGRPVADGRPGPVSRRLRA
LLQADLMEHGVPF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory