Comparing 8501867 FitnessBrowser__Miya:8501867 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P76015 PEP-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
60% identity, 100% coverage: 1:354/354 of query aligns to 1:355/356 of P76015
1uodA Crystal structure of the dihydroxyacetone kinase from e. Coli in complex with dihydroxyacetone-phosphate (see paper)
57% identity, 97% coverage: 10:354/354 of query aligns to 1:335/336 of 1uodA
1uoeA Crystal structure of the dihydroxyacetone kinase from e. Coli in complex with glyceraldehyde (see paper)
57% identity, 97% coverage: 10:354/354 of query aligns to 1:335/336 of 1uoeA
3pnqD Crystal structure of e.Coli dha kinase dhak (h56n) complex with dha (see paper)
57% identity, 97% coverage: 10:354/354 of query aligns to 1:333/334 of 3pnqD
Q9CIV8 PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
45% identity, 99% coverage: 2:350/354 of query aligns to 4:332/332 of Q9CIV8
3ct4A Structure of dha-kinase subunit dhak from l. Lactis (see paper)
44% identity, 96% coverage: 2:340/354 of query aligns to 1:307/318 of 3ct4A
Q3LXA3 Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 from Homo sapiens (Human) (see 4 papers)
39% identity, 97% coverage: 2:345/354 of query aligns to 4:330/575 of Q3LXA3
Sites not aligning to the query:
P45510 Dihydroxyacetone kinase; DHA kinase; Glycerone kinase; EC 2.7.1.29 from Citrobacter freundii (see 2 papers)
33% identity, 95% coverage: 4:340/354 of query aligns to 5:316/552 of P45510
Sites not aligning to the query:
1un9A Crystal structure of the dihydroxyacetone kinase from c. Freundii in complex with amp-pnp and mg2+ (see paper)
34% identity, 89% coverage: 27:340/354 of query aligns to 31:316/537 of 1un9A
Sites not aligning to the query:
>8501867 FitnessBrowser__Miya:8501867
MKKLINAVENVVREQLQGMAAAHPELRVNIDPHFVCRKEIPQGKVAIVSGGGSGHEPMHG
GFVGHGMLDGACPGEVFTSPTPDQMYECAKAVDRGAGVLFIVKNYTGDVMNFETAAELCH
ADGLKVQNILIDDDVAVKDSLYTAGRRGVGTTVLAEKIVGAAAEAGYDLDKCADLCRKVN
QYGRSMGMALTPCTVPAAGKPTFELAENEIEIGIGIHGEPGTQRAPMKTVDELVQIMATT
IIDDPAYTRTVRELDRVSGQWVDKSLTDAPFAKGDKVIAFVNSMGGTPVSELYAVYRKLA
EICGARGISIVRNLIGPYITSLEMQGFSITLLKVDDEILKFWDAKAITPGLRMG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory