Comparing 8501896 FitnessBrowser__Miya:8501896 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
59% identity, 100% coverage: 1:234/234 of query aligns to 6:239/240 of 1ji0A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
34% identity, 99% coverage: 2:233/234 of query aligns to 3:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
34% identity, 99% coverage: 2:233/234 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
34% identity, 99% coverage: 2:233/234 of query aligns to 3:235/238 of 6s8gA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
32% identity, 100% coverage: 1:233/234 of query aligns to 2:235/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
34% identity, 99% coverage: 2:233/234 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
34% identity, 99% coverage: 2:232/234 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
34% identity, 99% coverage: 2:232/234 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
34% identity, 98% coverage: 2:231/234 of query aligns to 3:233/233 of 6b8bA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 100% coverage: 1:233/234 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 100% coverage: 1:233/234 of query aligns to 4:253/253 of 1g9xB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 95% coverage: 1:222/234 of query aligns to 1:224/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 99% coverage: 1:232/234 of query aligns to 2:236/241 of 4u00A
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
31% identity, 85% coverage: 19:217/234 of query aligns to 270:478/501 of P04983
Sites not aligning to the query:
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
31% identity, 97% coverage: 2:229/234 of query aligns to 11:246/257 of P0AAH0
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
29% identity, 93% coverage: 1:217/234 of query aligns to 3:222/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
29% identity, 93% coverage: 1:217/234 of query aligns to 3:222/229 of 6z67B
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
31% identity, 84% coverage: 16:212/234 of query aligns to 1006:1199/2435 of Q9BZC7
Sites not aligning to the query:
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
29% identity, 88% coverage: 16:221/234 of query aligns to 3825:4029/5034 of Q5SSE9
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 91% coverage: 2:213/234 of query aligns to 4:213/369 of P19566
Sites not aligning to the query:
>8501896 FitnessBrowser__Miya:8501896
MLELRNVNAFYGNIQALRDINLTIGQGEIVTLIGANGAGKTTTLMTVCGAVPPRTGEVLF
EGKPIHTMKPNEIVRLGISQVPEGRLIFPDLTVQENLDLGAFLRNDKDGIARDLDYIFGL
FPILAQRRKQAGGTLSGGEQQMLAISRAIMGRPRLLLLDEPSLGLAPIIIQQIFDIIRKI
NADGTTVFLVEQNANQALKIAHRAYVMETGRITLEDTAANLLVNEDVKKAYLGM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory