Comparing 8501910 FitnessBrowser__Miya:8501910 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
37% identity, 81% coverage: 54:314/324 of query aligns to 35:281/288 of 3u9eB
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
37% identity, 81% coverage: 54:314/324 of query aligns to 33:279/285 of 3uf6A
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 82% coverage: 36:302/324 of query aligns to 405:692/714 of Q8ZND6
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
27% identity, 90% coverage: 34:324/324 of query aligns to 19:339/339 of 6ioxA
6zngF Maeb full-length acetyl-coa bound state (see paper)
26% identity, 83% coverage: 16:285/324 of query aligns to 412:708/753 of 6zngF
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
26% identity, 84% coverage: 43:314/324 of query aligns to 51:323/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
26% identity, 84% coverage: 43:314/324 of query aligns to 50:322/332 of 2af3C
>8501910 FitnessBrowser__Miya:8501910
MTTEAKICQGPHTGGQGPSSLDELVARVAACGARPRIALAACAEAHALGALLDAMERGIA
QPLLVGDMDQTARIAAELGRDISGIAAVHAPDPREAVQCAVDMVRRGEADVLMKGLVNTD
VLLRRVLNRATGLPPKGVLSHVAVFELPASGGTTRLAMMTDAAVNIRPNLQRKLEIVHNA
VAVARALGIARPRVAMLAATEKVILPAMPATLDAQIVARMAEQGEFGEADVAGPMALDIA
LSPDAAARKGVDHPVAGCADILVAPDIESGNILYKSLTILARADMASTMAGSSAPLVVTS
RGDSERSKFCSIALAGYLALAARS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory