Comparing 8501943 FitnessBrowser__Miya:8501943 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
40% identity, 80% coverage: 45:299/317 of query aligns to 30:266/267 of 3q1xA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
40% identity, 80% coverage: 45:299/317 of query aligns to 32:268/270 of 3p47A
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
48% identity, 54% coverage: 124:293/317 of query aligns to 92:252/280 of 7bw9A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
40% identity, 54% coverage: 129:300/317 of query aligns to 74:236/243 of 4n69A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
35% identity, 56% coverage: 123:300/317 of query aligns to 70:238/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
35% identity, 56% coverage: 123:300/317 of query aligns to 68:236/243 of 7ra4A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
38% identity, 54% coverage: 129:300/317 of query aligns to 70:226/233 of 4n6bA
Sites not aligning to the query:
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
34% identity, 54% coverage: 124:294/317 of query aligns to 70:231/250 of 4hzdA
Sites not aligning to the query:
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
32% identity, 58% coverage: 126:310/317 of query aligns to 68:251/257 of 1ssqD
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
32% identity, 53% coverage: 129:295/317 of query aligns to 75:232/262 of 1t3dA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
32% identity, 54% coverage: 129:299/317 of query aligns to 71:232/258 of 4h7oA
Sites not aligning to the query:
1sstA Serine acetyltransferase- complex with coa (see paper)
31% identity, 53% coverage: 126:294/317 of query aligns to 68:220/233 of 1sstA
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
31% identity, 55% coverage: 136:310/317 of query aligns to 85:258/272 of 3gvdI
>8501943 FitnessBrowser__Miya:8501943
MKKLDDLDARSLQGMPELERIVDEMCAPESYEAVYHRSLHDAPMPSLEALAEMVSRLRAA
LLPGFFGAATVHMESMRYHLAANLDSIYRILSEQIRRGACFTCADFARECGSCELHSRDK
AIQFLQRLPEIRRMLASDVKAAYEGDPAAKSPGETVFCYPSIAAMINHRIAHELYRMEVP
LIPRIISEMAHSRTGIDIHPGARIDEEFFIDHGTGVVIGETCIIGRGCRIYQGVTLGALS
FPKDGDGVLIKGNPRHPILEDNVTVYAGATILGRVTIGAGSMIGGNVWVTHDVPPGSKIV
QQRSAKPKPDEELVGRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory