Comparing 8501972 DvMF_2686 polar amino acid ABC transporter, inner membrane subunit (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
38% identity, 63% coverage: 114:313/316 of query aligns to 15:215/215 of 4ymtC
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
38% identity, 63% coverage: 114:312/316 of query aligns to 15:214/214 of 4ymwC
>8501972 DvMF_2686 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
MLRHRMENSRHSRDSSAPGHPTAHGTGTDAPGDSSRPNPAPPARQAPEVPAPPPARRALL
AVLGDVTRYCCLLGALTWITLRGTAASGYDWQWHRLWRHLFTTAGDGGLRAGPLLDGLGV
TVQVVAASLGLALLAGLLAALLRQSGSRVGRALAVAYVETVRNTPLLIQLFVVYFVLAPV
LGLGRFAAGVLALSLFEGAYIAEILRAGILSVPTGQWEASRSLGMDVPGTYMEVVLPQAA
RTALPPLTGQLVSLVKDSSLVSTIALHDLAMQAQAVAADTFLVFEVWFLVAGMYLALTLS
LSALAQLLERRLRYEF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory