Comparing 8502040 FitnessBrowser__Miya:8502040 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
35% identity, 98% coverage: 1:250/255 of query aligns to 2:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
35% identity, 98% coverage: 1:250/255 of query aligns to 2:253/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
35% identity, 98% coverage: 2:250/255 of query aligns to 1:235/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
37% identity, 98% coverage: 4:252/255 of query aligns to 3:237/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
37% identity, 98% coverage: 4:252/255 of query aligns to 3:237/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
36% identity, 98% coverage: 4:252/255 of query aligns to 4:238/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
36% identity, 97% coverage: 4:250/255 of query aligns to 3:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
36% identity, 96% coverage: 4:249/255 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
36% identity, 96% coverage: 4:249/255 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
36% identity, 96% coverage: 4:248/255 of query aligns to 3:233/233 of 6b8bA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 95% coverage: 2:243/255 of query aligns to 1:228/241 of 4u00A
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
31% identity, 97% coverage: 3:250/255 of query aligns to 6:238/240 of 1ji0A
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
28% identity, 100% coverage: 2:255/255 of query aligns to 3:244/501 of P04983
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 95% coverage: 3:243/255 of query aligns to 1:233/343 of P30750
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 95% coverage: 1:243/255 of query aligns to 1:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 95% coverage: 1:243/255 of query aligns to 1:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 95% coverage: 1:243/255 of query aligns to 1:230/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 95% coverage: 1:243/255 of query aligns to 1:230/242 of 2oljA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 95% coverage: 3:243/255 of query aligns to 2:234/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 95% coverage: 3:243/255 of query aligns to 2:234/344 of 3tuzC
Sites not aligning to the query:
>8502040 FitnessBrowser__Miya:8502040
MSLLALRNLTKTFGGLVAVNNVTFDVAEGSIVGLIGPNGAGKTTVFNLITGNYKPDSGDI
FFDGRTIKGLPTHRIVQQGIARTFQTIRLFQNMSVIENVLAGCHCRMQSGMLSAMLRTPA
QRAEEQRALLRATRELEFVGLANEHANLAKNLSYGNQRLLEIARALATDPRFIILDEPAG
GMNDQETAALIDTIRAIRDRGITVLLIEHDMSLVMKVCEKLVVLEYGALLAEGVPAAIKD
DPRVIEAYLGADTDD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory