Comparing 8502074 FitnessBrowser__Miya:8502074 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
40% identity, 81% coverage: 36:258/275 of query aligns to 6:226/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
39% identity, 81% coverage: 36:258/275 of query aligns to 6:224/225 of 4zv2A
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
40% identity, 73% coverage: 58:257/275 of query aligns to 38:234/243 of 5eyfB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
35% identity, 84% coverage: 27:257/275 of query aligns to 3:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
32% identity, 84% coverage: 28:257/275 of query aligns to 4:227/229 of 6svfA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
34% identity, 74% coverage: 54:256/275 of query aligns to 73:271/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
33% identity, 77% coverage: 54:266/275 of query aligns to 72:280/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
33% identity, 77% coverage: 54:266/275 of query aligns to 72:280/287 of 6h1uA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
30% identity, 76% coverage: 57:264/275 of query aligns to 18:217/217 of 2pyyB
Sites not aligning to the query:
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
28% identity, 84% coverage: 27:258/275 of query aligns to 6:231/237 of 3vv5A
2vhaA Debp (see paper)
27% identity, 87% coverage: 23:262/275 of query aligns to 4:250/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
27% identity, 87% coverage: 23:262/275 of query aligns to 5:251/278 of 2ia4B
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
28% identity, 84% coverage: 27:258/275 of query aligns to 10:235/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
28% identity, 84% coverage: 27:258/275 of query aligns to 10:235/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
28% identity, 84% coverage: 27:258/275 of query aligns to 10:235/241 of 3vvdA
5lomB Crystal structure of the pbp soca from agrobacterium tumefaciens c58 in complex with dfg at 1.5 a resolution (see paper)
29% identity, 85% coverage: 36:268/275 of query aligns to 14:239/250 of 5lomB
5l9oB Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
29% identity, 85% coverage: 36:268/275 of query aligns to 13:238/243 of 5l9oB
5l9oA Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
29% identity, 85% coverage: 36:268/275 of query aligns to 12:237/241 of 5l9oA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
32% identity, 82% coverage: 33:258/275 of query aligns to 2:222/226 of 8eyzA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
27% identity, 85% coverage: 23:257/275 of query aligns to 2:243/503 of 8ovoA
>8502074 FitnessBrowser__Miya:8502074
MRLVKLLAMASALTVLMASVAMAGPVFDRIQKEKKIRIGIMTDSIPGAFYNEKGEWGGFD
YDMATEVAKRMGVEIERVQVNNKTRIALVQSGQIDLSVSNMTHTRERDKSVDFSLTYFFD
GQKILAKKGQFKSVKDMVGKKIATMQGTTSEVNVRRALKEAGDPNAETNVISFQKESECF
QALQNGRVAGWSTDASILVGYAAKTPGQFELVGDFLSDEPYGMAMPQDDSALRDAVNAAI
QDMWKDGTYKSIYNKWYGPGTPFEMPLAGQIEMWP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory