SitesBLAST
Comparing 8502147 FitnessBrowser__Miya:8502147 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
39% identity, 97% coverage: 8:245/245 of query aligns to 11:259/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (≠ T140), N144 (≠ S141), T145 (≠ V142), F153 (≠ Y150), Y156 (= Y153), G187 (= G184), M193 (≠ L190), V197 (vs. gap), A259 (= A245)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), I20 (= I17), A40 (= A37), N41 (≠ S38), S42 (≠ N39), D66 (= D63), N93 (≠ S90), S94 (≠ A91), L116 (≠ T113), T141 (≠ L138), Y156 (= Y153), K160 (= K157), P186 (= P183), G187 (= G184), G188 (≠ P185), T189 (≠ V186), T191 (= T188), M193 (≠ L190)
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
39% identity, 97% coverage: 8:245/245 of query aligns to 15:264/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S141), Y161 (= Y153), G193 (≠ P185), M198 (≠ L190), F199 (= F191), V202 (vs. gap), S203 (vs. gap), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G12), R22 (= R15), G23 (= G16), I24 (= I17), Y43 (= Y36), A44 (= A37), N45 (≠ S38), S46 (≠ N39), D70 (= D63), V71 (= V64), N97 (≠ S90), S98 (≠ A91), L120 (≠ T113), T145 (≠ S139), S147 (= S141), Y161 (= Y153), K165 (= K157), P191 (= P183), G192 (= G184), T194 (≠ V186), T196 (= T188), M198 (≠ L190)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
39% identity, 96% coverage: 8:243/245 of query aligns to 11:258/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (≠ V142), T145 (≠ I143), F154 (≠ Y150), G189 (≠ P185), V198 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), I20 (= I17), Y39 (= Y36), A40 (= A37), N41 (≠ S38), S42 (≠ N39), D66 (= D63), V67 (= V64), N93 (≠ S90), S94 (≠ A91), L116 (≠ T113), T141 (≠ S139), Y157 (= Y153), K161 (= K157), P187 (= P183), T190 (≠ V186), T192 (= T188), M194 (≠ L190)
Sites not aligning to the query:
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 98% coverage: 6:244/245 of query aligns to 5:244/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
39% identity, 98% coverage: 6:244/245 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G16), S138 (≠ T140), Q148 (≠ Y150), Y151 (= Y153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (= S14), R11 (= R15), I13 (= I17), N31 (= N35), Y32 (= Y36), A33 (= A37), G34 (≠ S38), S35 (≠ N39), A58 (= A62), N59 (≠ D63), V60 (= V64), N86 (≠ S90), A87 (= A91), T109 (= T113), S138 (≠ T140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
37% identity, 97% coverage: 8:245/245 of query aligns to 10:259/259 of 4fj1B
- active site: G18 (= G16), S142 (= S141), N143 (≠ V142), H153 (≠ Y150), Y156 (= Y153), K160 (= K157), Y201 (vs. gap)
- binding genistein: G188 (≠ P185), F194 (= F191), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (≠ A202), A217 (≠ I203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G12), R17 (= R15), G18 (= G16), I19 (= I17), A39 (= A37), N40 (≠ S38), S41 (≠ N39), I66 (≠ V64), N92 (≠ S90), S93 (≠ A91), G94 (= G92), L115 (≠ T113), T140 (≠ S139), S142 (= S141), Y156 (= Y153), K160 (= K157), G187 (= G184), T189 (≠ V186), T191 (= T188), M193 (≠ L190)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
37% identity, 97% coverage: 8:245/245 of query aligns to 11:260/260 of 4fj2B
- active site: G19 (= G16), S143 (= S141), N144 (≠ V142), H154 (≠ Y150), Y157 (= Y153), K161 (= K157), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), G19 (= G16), I20 (= I17), A40 (= A37), N41 (≠ S38), S42 (≠ N39), I67 (≠ V64), N93 (≠ S90), S94 (≠ A91), G95 (= G92), L116 (≠ T113), T141 (≠ S139), Y157 (= Y153), K161 (= K157), G188 (= G184), G189 (≠ P185), T190 (≠ V186), T192 (= T188), M194 (≠ L190)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ P185), F195 (= F191), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (≠ A202), A218 (≠ I203)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
37% identity, 97% coverage: 8:245/245 of query aligns to 12:261/261 of 4fj0D
- active site: G20 (= G16), S144 (= S141), N145 (≠ V142), H155 (≠ Y150), Y158 (= Y153), K162 (= K157), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S141), N145 (≠ V142), G190 (≠ P185), F196 (= F191), S200 (vs. gap), Y203 (vs. gap), A219 (≠ I203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G12), R19 (= R15), G20 (= G16), I21 (= I17), A41 (= A37), N42 (≠ S38), S43 (≠ N39), I68 (≠ V64), N94 (≠ S90), S95 (≠ A91), G96 (= G92), L117 (≠ T113), T142 (≠ S139), Y158 (= Y153), K162 (= K157), P188 (= P183), G189 (= G184), G190 (≠ P185), T191 (≠ V186), T193 (= T188), M195 (≠ L190)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
37% identity, 97% coverage: 8:245/245 of query aligns to 11:260/260 of 3qwiA
- active site: G19 (= G16), S143 (= S141), N144 (≠ V142), H154 (≠ Y150), Y157 (= Y153), K161 (= K157), Y202 (vs. gap)
- binding Coumestrol: F149 (= F147), G189 (≠ P185), M194 (≠ L190), Y202 (vs. gap), I203 (vs. gap), A218 (≠ I203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), I20 (= I17), A40 (= A37), N41 (≠ S38), S42 (≠ N39), I67 (≠ V64), N93 (≠ S90), S94 (≠ A91), G95 (= G92), L116 (≠ T113), T141 (≠ S139), Y157 (= Y153), K161 (= K157), P187 (= P183), G188 (= G184), G189 (≠ P185), T190 (≠ V186), T192 (= T188), M194 (≠ L190)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
37% identity, 97% coverage: 8:245/245 of query aligns to 11:260/260 of 3qwhA
- active site: G19 (= G16), S143 (= S141), N144 (≠ V142), H154 (≠ Y150), Y157 (= Y153), K161 (= K157), Y202 (vs. gap)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (≠ V142), F149 (= F147), G189 (≠ P185), F195 (= F191), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), A218 (≠ I203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), G19 (= G16), I20 (= I17), A40 (= A37), N41 (≠ S38), S42 (≠ N39), D66 (= D63), I67 (≠ V64), N93 (≠ S90), S94 (≠ A91), G95 (= G92), L116 (≠ T113), T141 (≠ S139), Y157 (= Y153), K161 (= K157), P187 (= P183), G188 (= G184), G189 (≠ P185), T190 (≠ V186), T192 (= T188), M194 (≠ L190)
1ybvA Structure of trihydroxynaphthalene reductase in complex with NADPH and an active site inhibitor (see paper)
35% identity, 96% coverage: 8:243/245 of query aligns to 19:267/270 of 1ybvA
- active site: G27 (= G16), S151 (= S139), H162 (≠ Y150), Y165 (= Y153), K169 (= K157), Y210 (vs. gap)
- binding 5-methyl-1,2,4-triazolo[3,4-b]benzothiazole: S151 (= S139), Y165 (= Y153), G197 (≠ P185), M202 (≠ L190), Y203 (≠ F191), Y210 (vs. gap), W230 (≠ L206)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G12), R26 (= R15), G27 (= G16), I28 (= I17), A48 (= A37), N49 (≠ S38), S50 (≠ N39), N74 (≠ D63), V75 (= V64), N101 (≠ S90), S102 (≠ A91), G103 (= G92), M149 (≠ L138), S151 (= S139), K169 (= K157), P195 (= P183), G197 (≠ P185), I198 (≠ V186), T200 (= T188), M202 (≠ L190)
1g0oC Structure of trihydroxynaphthalene reductase in complex with NADPH and pyroquilon (see paper)
35% identity, 96% coverage: 8:243/245 of query aligns to 30:278/281 of 1g0oC
- active site: G38 (= G16), S162 (= S139), H173 (≠ Y150), Y176 (= Y153), K180 (= K157), Y221 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G34 (= G12), R37 (= R15), G38 (= G16), I39 (= I17), A59 (= A37), N60 (≠ S38), S61 (≠ N39), N85 (≠ D63), V86 (= V64), N112 (≠ S90), S113 (≠ A91), G114 (= G92), M160 (≠ L138), Y176 (= Y153), K180 (= K157), P206 (= P183), G208 (≠ P185), I209 (≠ V186), T211 (= T188), M213 (≠ L190)
- binding pyroquilon: S162 (= S139), I163 (≠ T140), Y176 (= Y153), G208 (≠ P185), Y221 (vs. gap)
1g0nA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4,5,6,7-tetrachloro-phthalide (see paper)
35% identity, 96% coverage: 8:243/245 of query aligns to 22:270/273 of 1g0nA
- active site: G30 (= G16), S154 (= S139), H165 (≠ Y150), Y168 (= Y153), K172 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G12), R29 (= R15), G30 (= G16), I31 (= I17), A51 (= A37), N52 (≠ S38), S53 (≠ N39), V78 (= V64), N104 (≠ S90), S105 (≠ A91), G106 (= G92), I127 (≠ T113), M152 (≠ L138), Y168 (= Y153), K172 (= K157), P198 (= P183), G200 (≠ P185), I201 (≠ V186), T203 (= T188), M205 (≠ L190)
- binding 4,5,6,7-tetrachloro-phthalide: S154 (= S139), Y168 (= Y153), G200 (≠ P185), M205 (≠ L190), Y206 (≠ F191), C210 (vs. gap), Y213 (vs. gap), W233 (≠ L206)
1dohA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4-nitro-inden-1-one (see paper)
35% identity, 96% coverage: 8:243/245 of query aligns to 22:270/273 of 1dohA
- active site: G30 (= G16), S154 (= S139), H165 (≠ Y150), Y168 (= Y153), K172 (= K157), Y213 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G12), R29 (= R15), G30 (= G16), I31 (= I17), A51 (= A37), N52 (≠ S38), S53 (≠ N39), N77 (≠ D63), V78 (= V64), N104 (≠ S90), S105 (≠ A91), G106 (= G92), M152 (≠ L138), Y168 (= Y153), K172 (= K157), P198 (= P183), G200 (≠ P185), I201 (≠ V186), T203 (= T188), M205 (≠ L190)
- binding 4-nitro-inden-1-one: Y168 (= Y153), G200 (≠ P185), Y206 (≠ F191), C210 (vs. gap), Y213 (vs. gap)
Q12634 Tetrahydroxynaphthalene reductase; T4HN reductase; THNR; EC 1.1.1.252 from Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae) (see 2 papers)
36% identity, 96% coverage: 8:243/245 of query aligns to 32:280/283 of Q12634
- 39:63 (vs. 15:39, 52% identical) binding
- Y178 (= Y153) active site, Proton acceptor
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
38% identity, 97% coverage: 6:243/245 of query aligns to 7:247/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), S15 (= S14), R16 (= R15), G17 (= G16), I18 (= I17), H36 (≠ N35), Y37 (= Y36), G38 (≠ A37), H39 (≠ S38), L65 (≠ V64), N97 (≠ S90), G99 (= G92), S147 (≠ T140), Y160 (= Y153), K164 (= K157), G191 (= G184), T193 (≠ V186), T195 (= T188)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
41% identity, 98% coverage: 4:244/245 of query aligns to 5:244/247 of P73574
- A14 (≠ G13) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P148) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K157) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ P185) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ K195) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
39% identity, 97% coverage: 9:245/245 of query aligns to 5:243/244 of 1edoA
- active site: G12 (= G16), S138 (≠ T140), Y151 (= Y153), K155 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (= S14), R11 (= R15), I13 (= I17), N31 (= N35), Y32 (= Y36), A33 (= A37), R34 (≠ S38), S35 (≠ N39), D59 (= D63), V60 (= V64), N86 (≠ S90), A87 (= A91), S138 (≠ T140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), I184 (≠ V186), S186 (≠ T188), M188 (≠ L190)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
46% identity, 98% coverage: 4:244/245 of query aligns to 4:237/240 of 4dmmB
- active site: G16 (= G16), S142 (≠ T140), Q152 (≠ Y150), Y155 (= Y153), K159 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (= S14), R15 (= R15), G16 (= G16), I17 (= I17), A37 (= A37), S38 (= S38), S39 (≠ N39), A62 (= A62), D63 (= D63), V64 (= V64), N90 (≠ S90), A91 (= A91), L113 (≠ T113), I140 (≠ L138), S142 (≠ T140), Y155 (= Y153), K159 (= K157), P185 (= P183), G186 (= G184), I188 (≠ V186), T190 (= T188), M192 (≠ L190)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
37% identity, 97% coverage: 8:245/245 of query aligns to 8:244/245 of 5wuwA
- active site: G16 (= G16), S140 (= S139), Y154 (= Y153), L161 (≠ V160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), R15 (= R15), I17 (= I17), Y36 (= Y36), A37 (= A37), A38 (≠ S38), D63 (= D63), S64 (≠ V64), N90 (≠ S90), A91 (= A91), G92 (= G92), Y154 (= Y153), K158 (= K157), G185 (= G184), P186 (= P185), V187 (= V186)
Query Sequence
>8502147 FitnessBrowser__Miya:8502147
METTARNAIVTGGSRGIGRAIALRLAQDGFCVVVNYASNAPAALEVVDAIARTGGQAVAV
PADVGETGDVEGLFAAAHDAFGQVGVVVNSAGIMPMLPIAGGDTAAFEKVLRTNLTGTFN
VLSRAANALTAGGRIIALSTSVIAKPFPGYGPYIASKAGVEGLVRVLANELRGRSITVNA
VAPGPVATDLFLNGKTEEQIAAIGKLAPLERLGTPEEIAGVVSFLVGPEGGWINAQVVRV
NGGFA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory