SitesBLAST
Comparing 8502165 FitnessBrowser__Miya:8502165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
33% identity, 98% coverage: 8:472/474 of query aligns to 6:462/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ A74), G75 (= G76), S76 (≠ R77), G77 (≠ A78), T78 (≠ S79), G79 (≠ N80), L80 (≠ Q81), A83 (= A84), C84 (= C85), P137 (= P138), G138 (≠ A139), E139 (≠ S140), A142 (≠ S144), T143 (= T145), G146 (= G148), N147 (= N149), S149 (≠ A151), T150 (= T152), A152 (= A154), G153 (= G155), E203 (= E205), G204 (= G206), I209 (≠ V211), E422 (= E432), H423 (= H433)
- binding fe (iii) ion: H377 (= H388), H384 (= H395), E422 (= E432)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:453/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), W322 (= W336), E413 (= E432), H414 (= H433), N450 (= N469)
- binding lactic acid: R318 (≠ H325), H369 (= H388), H376 (= H395), H414 (= H433)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E413 (= E432)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:453/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (≠ H325), H369 (= H388), H376 (= H395), H414 (= H433)
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), W322 (= W336), E413 (= E432), H414 (= H433), N450 (= N469)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E413 (= E432)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:453/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (≠ H325), W322 (= W336), H369 (= H388), H376 (= H395), H414 (= H433)
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), W322 (= W336), E413 (= E432), N450 (= N469)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E413 (= E432)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:454/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), W323 (≠ S343), E414 (= E432), H415 (= H433), N451 (= N469)
- binding manganese (ii) ion: H370 (= H388), H377 (= H395), E414 (= E432)
- binding pyruvic acid: R319 (= R339), H370 (= H388), H377 (= H395), H415 (= H433)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:452/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ Q81), R317 (≠ H325), W321 (= W336), H368 (= H388), H375 (= H395), H413 (= H433)
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), W321 (= W336), Y322 (≠ A337), E412 (= E432), H413 (= H433), N449 (= N469)
- binding manganese (ii) ion: H368 (= H388), H375 (= H395), E412 (= E432)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:453/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), H369 (= H388), E413 (= E432), N450 (= N469)
- binding deaminohydroxyvaline: R319 (= R339), H414 (= H433)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:453/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), W322 (≠ S343), E413 (= E432), H414 (= H433), N450 (= N469)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R339), H369 (= H388), H376 (= H395), H414 (= H433)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E413 (= E432)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:454/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), Y324 (≠ P344), H370 (= H388), E414 (= E432), N451 (= N469)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R339), W323 (≠ S343), H415 (= H433)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:454/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R339), W323 (≠ S343), H370 (= H388), H415 (= H433)
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), H370 (= H388), E414 (= E432), N451 (= N469)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:454/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R339), W323 (≠ S343), H415 (= H433)
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), Y324 (≠ P344), H370 (= H388), E414 (= E432), N451 (= N469)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:454/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), H370 (= H388), E414 (= E432), N451 (= N469)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R339), W323 (≠ S343), H415 (= H433)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:454/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), H370 (= H388), E414 (= E432), N451 (= N469)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R339), H415 (= H433)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:454/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), Y324 (≠ P344), H370 (= H388), E414 (= E432), N451 (= N469)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ Q81), R319 (= R339), W323 (≠ S343), H415 (= H433)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:452/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R339), W322 (≠ S343), H369 (= H388), H376 (= H395), H413 (= H433)
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), W322 (≠ S343), E412 (= E432), H413 (= H433), N449 (= N469)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E412 (= E432)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
33% identity, 91% coverage: 42:472/474 of query aligns to 36:452/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R339), W322 (≠ S343), S336 (≠ G355), H369 (= H388), H376 (= H395), H413 (= H433)
- binding flavin-adenine dinucleotide: P68 (≠ A74), G70 (= G76), T71 (≠ R77), G72 (≠ A78), T73 (≠ S79), G74 (≠ N80), G78 (≠ A84), V79 (≠ C85), L90 (= L96), P132 (= P138), G133 (≠ A139), A134 (≠ S140), G140 (= G148), M141 (≠ N149), A143 (= A151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (≠ V211), E412 (= E432), N449 (= N469)
- binding manganese (ii) ion: H369 (= H388), H376 (= H395), E412 (= E432)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 90% coverage: 46:470/474 of query aligns to 40:452/459 of P9WIT1
- K354 (≠ D367) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
32% identity, 91% coverage: 44:472/474 of query aligns to 46:463/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ A74), G78 (= G76), G79 (≠ R77), N80 (≠ A78), T81 (≠ S79), G82 (≠ N80), M83 (≠ Q81), G86 (≠ A84), S87 (≠ C85), L140 (≠ P138), A142 (≠ S140), C146 (≠ S144), H147 (≠ T145), G150 (= G148), N151 (= N149), A153 (= A151), T154 (= T152), G208 (= G206), I212 (= I210), I213 (≠ V211), E423 (= E432), N460 (= N469)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
32% identity, 91% coverage: 44:472/474 of query aligns to 45:462/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R339), T337 (≠ S343), K348 (≠ E356), Y379 (= Y386), H381 (= H388), H388 (= H395), H423 (= H433)
- binding flavin-adenine dinucleotide: P75 (≠ A74), Q76 (≠ R75), G77 (= G76), G78 (≠ R77), N79 (≠ A78), T80 (≠ S79), G81 (≠ N80), M82 (≠ Q81), G85 (≠ A84), S86 (≠ C85), L139 (≠ P138), G140 (≠ A139), A141 (≠ S140), C145 (≠ S144), G149 (= G148), N150 (= N149), A152 (= A151), T153 (= T152), G157 (= G156), G207 (= G206), I212 (≠ V211), E422 (= E432), N459 (= N469)
- binding zinc ion: H381 (= H388), H388 (= H395), E422 (= E432)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
32% identity, 91% coverage: 44:472/474 of query aligns to 45:462/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ A74), G77 (= G76), G78 (≠ R77), N79 (≠ A78), T80 (≠ S79), G81 (≠ N80), G85 (≠ A84), S86 (≠ C85), L139 (≠ P138), G140 (≠ A139), A141 (≠ S140), C145 (≠ S144), H146 (≠ T145), G148 (= G147), G149 (= G148), N150 (= N149), A152 (= A151), T153 (= T152), A155 (= A154), E206 (= E205), G207 (= G206), I211 (= I210), I212 (≠ V211), E422 (= E432), N459 (= N469)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R339), T337 (≠ S343), K348 (≠ E356), Y379 (= Y386), H381 (= H388), H388 (= H395), H423 (= H433)
- binding zinc ion: H381 (= H388), H388 (= H395), E422 (= E432)
Sites not aligning to the query:
Query Sequence
>8502165 FitnessBrowser__Miya:8502165
MSTQAPHLSATQERSLRDIFPGDSLLLTPEQTLIFATDAGRRMGTPLAVVRPTTEAQVVE
LLRLAQAERLPVYARGRASNQVGACVPDRPGIVVSLLHMNRILDIADDDFVAEVEPGVVT
SDLQRAVEARGLFYPPDPASIDISTIGGNVATCAGGMRALKYGVTREYVLGLTAVLPGGR
VLHTGGRCHKNVVGLDLTRLFVGSEGTLGIVTRITLKLLPLPQATATLLAGFGSMEAAMH
GVRRIFRAGILPVALEFLSPEVLDCVARRQTPPWPDSVRGALLIRLDGSRESLPLEVRRM
HDALHSPGNAAGATSGNEPPLWSAHGVGHDEEEPLWAMRRGISPSSYLVRPNKIGEDIAV
PRGRLLDALTGIRAIAQAHDLPILTYGHVGDGNIHVNIMYDGADPSETTRADAATVEVMR
LVRSMDGTLSGEHGVGMAKKEFLHLQLSPLETELMRQVKHAFDPLGIMNPDKAY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory