Comparing 8502215 FitnessBrowser__Miya:8502215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
51% identity, 81% coverage: 36:246/260 of query aligns to 49:248/252 of 3qdfA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
43% identity, 82% coverage: 36:248/260 of query aligns to 49:269/269 of 4dbhA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
43% identity, 78% coverage: 44:245/260 of query aligns to 87:301/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
43% identity, 78% coverage: 44:245/260 of query aligns to 86:300/303 of 8skyB
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
39% identity, 78% coverage: 38:239/260 of query aligns to 49:272/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
39% identity, 78% coverage: 38:239/260 of query aligns to 49:272/290 of 8gsrA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
43% identity, 78% coverage: 42:245/260 of query aligns to 62:274/277 of 6iymA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
43% identity, 79% coverage: 35:239/260 of query aligns to 62:254/264 of 6jvwB
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
40% identity, 72% coverage: 51:236/260 of query aligns to 20:210/224 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
40% identity, 72% coverage: 51:236/260 of query aligns to 15:205/218 of 6fogA
Sites not aligning to the query:
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
40% identity, 72% coverage: 51:238/260 of query aligns to 14:206/216 of 6sbiA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
34% identity, 79% coverage: 41:246/260 of query aligns to 62:277/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
34% identity, 79% coverage: 41:246/260 of query aligns to 62:277/280 of 6j5xA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
36% identity, 81% coverage: 35:245/260 of query aligns to 48:260/265 of 3r6oA
1gttA Crystal structure of hpce (see paper)
40% identity, 67% coverage: 51:223/260 of query aligns to 225:392/421 of 1gttA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
35% identity, 83% coverage: 34:248/260 of query aligns to 53:278/279 of 6v77B
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
33% identity, 72% coverage: 50:235/260 of query aligns to 17:209/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
35% identity, 73% coverage: 47:237/260 of query aligns to 7:224/247 of 1nkqA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
33% identity, 83% coverage: 26:241/260 of query aligns to 1:226/233 of 6j5yA
2q1dX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate (see paper)
26% identity, 87% coverage: 20:245/260 of query aligns to 46:276/281 of 2q1dX
>8502215 FitnessBrowser__Miya:8502215
MRVVRVQYKGSVFFGALQDDGVVCLNHQLGLKDPIPLADLAILPVVAPSKIICAGMNYRD
HAAEIGFPVPDEPVFFLKAPTAVIGSGQPILVPQGVGRVDYEGELAIVVGRQCRNISPDA
VPAHVFGYTCANDVTARDQQRRDGLFGRCKGYDTFCPVGPWIETDLPDTASLAVRTLVNG
EVRQQGNTADMLFTPNEMVSAISRVMTLLPGDLILTGTPVGVGPIVPGDEVRVEIEQVGL
LINPVLTAPDGDEHAEVPLQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory