Comparing 8502321 DvMF_3029 ABC transporter related (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
33% identity, 89% coverage: 26:505/537 of query aligns to 1:484/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 40% coverage: 28:244/537 of query aligns to 1:217/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 40% coverage: 37:250/537 of query aligns to 11:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 40% coverage: 37:250/537 of query aligns to 11:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 40% coverage: 37:250/537 of query aligns to 11:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 40% coverage: 37:250/537 of query aligns to 11:225/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 40% coverage: 29:244/537 of query aligns to 1:217/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 45% coverage: 29:269/537 of query aligns to 1:249/343 of P30750
Sites not aligning to the query:
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
31% identity, 43% coverage: 30:259/537 of query aligns to 5:238/249 of 4hluC
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
31% identity, 43% coverage: 30:259/537 of query aligns to 4:234/247 of 4zirB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
25% identity, 40% coverage: 29:244/537 of query aligns to 4:231/254 of 1g6hA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 45% coverage: 29:269/537 of query aligns to 2:250/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 45% coverage: 29:269/537 of query aligns to 2:250/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 45% coverage: 29:269/537 of query aligns to 2:250/344 of 3tuiC
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
29% identity, 45% coverage: 1:239/537 of query aligns to 1315:1553/2595 of E9Q876
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
25% identity, 40% coverage: 29:244/537 of query aligns to 4:231/253 of 1g9xB
7mdyC Lolcde nucleotide-bound
29% identity, 41% coverage: 29:246/537 of query aligns to 2:225/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
29% identity, 41% coverage: 29:246/537 of query aligns to 5:228/233 of P75957
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
27% identity, 44% coverage: 29:262/537 of query aligns to 2:235/240 of 6mjpA
7arlD Lolcde in complex with lipoprotein and adp (see paper)
30% identity, 36% coverage: 29:224/537 of query aligns to 2:204/222 of 7arlD
>8502321 DvMF_3029 ABC transporter related (RefSeq)
MSDTPHTHAAVAPETPRRVRETHAHLPPVVRLDGICKSFGKVRANHDITLDIRPGCIKAL
LGENGAGKSTLMSILAGKLRQDAGTIVVDGVPTVFASPRDALRAGIGMVYQHFMLVDSMT
VAENVLLGQSPDMLLRPARMRDEVAALAERYGLAVDPAARVGGLSMGERQRVEILKLLYR
DSRVLILDEPTAVLTPRETDQLFEAMWRMADQGKALVFISHKLQEVLTVADEIAILRRGE
VVDEFSEADVPNQTVLANRMVGRDVVLQVDAKRLTPVDTVLSVEHLSGAGLSDVSLQVRR
GEIVAIAGVAGNGQKELVEAICGLARPEAGEVRILGRPWREFFAGPPGRRGLAYIPEDRQ
GLATCRHLDLVDNFLLTTRNQFAKGVFLDRTEATNAVKRVVWEYNVQPGDITAPARALSG
GNLQKLVIGREFFRKPEVIVAENPTQGLDISATEEVWGRLLEARSTSGVLLVTGDLNEAL
ELADRIAVMYRGRFIDVFDKDDTAKVQAIGLMMAGVRPDDADGPGVADKAVEAEGRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory