Comparing 8502448 FitnessBrowser__Miya:8502448 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
32% identity, 93% coverage: 11:223/229 of query aligns to 4:214/214 of 4ymwC
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
32% identity, 93% coverage: 11:223/229 of query aligns to 4:214/215 of 4ymtC
>8502448 FitnessBrowser__Miya:8502448
MQWDVVWRNFDYLLVGSWPQGPLGGLAMSVVLAIGGIFGAFWLGLGFGLLRLSDRWWLRL
PAIIYVEIIRGIPLLMLIFWFYFLAPIVLGRTLPEAESALVAFIVFTGAYIAEIVRAGVL
ALPHGQMEAARGTGLSKSQAMIYVILPQALRNMIPSFVNQFVSLTKDTSLAYIIGVSELT
RTATQINNRELTAPAELFFTIAVLYFIVCWTLTAASRRMERQMARYQAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory